Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X2GAS0

Protein Details
Accession A0A1X2GAS0   
Localization Confidence Medium
Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
312-337TQMMRGFSAKKEKKDKKDKTTTVLEEHydrophilic
NLS Segment(s)
PositionSequence
54-68PAKPTPKPSRSATKR
320-328AKKEKKDKK
Subcellular Location(s) nucl 12, cyto_nucl 10.333, mito_nucl 9.333, cyto 7.5, mito 5.5
Family & Domain DBs
Amino Acid Sequences MSAEEAKVDQPVQEQPAVAPETEVAATPAAVEETPAEDVTKDEEAVEEAKKEEPAKPTPKPSRSATKRLSSFLTKAKKQFVPQDKPKAEKKVDLETKALPEGPKEEAVEEAAEEAAEETPKEEAKEEAAEASEQAAPAVEDKKEKRKSTFLNDIFKKVTPNTTAAAKEEPKAEEAPKEEEPKVEEQETAPAVEEPATEEASAPAVPPKDASKEATASVVSQLKRHSTNITKFFSKKTSTPVETKKEEAKEVVDEEPKAEEPKAEEPVAATSEVVEAPKEEKKEEAPAVPEKEQEDATEKPARAGSPLGRRLTQMMRGFSAKKEKKDKKDKTTTVLEEAKEEAKEEAKEEVKEEPKDEAKVTEEENKAEPAVAAATPAVEAAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.21
3 0.27
4 0.27
5 0.24
6 0.19
7 0.15
8 0.16
9 0.16
10 0.16
11 0.1
12 0.09
13 0.09
14 0.08
15 0.09
16 0.07
17 0.07
18 0.07
19 0.07
20 0.09
21 0.11
22 0.11
23 0.11
24 0.1
25 0.11
26 0.14
27 0.15
28 0.13
29 0.11
30 0.11
31 0.12
32 0.15
33 0.15
34 0.13
35 0.13
36 0.15
37 0.18
38 0.19
39 0.23
40 0.26
41 0.34
42 0.41
43 0.47
44 0.56
45 0.63
46 0.67
47 0.67
48 0.68
49 0.7
50 0.7
51 0.73
52 0.71
53 0.7
54 0.68
55 0.65
56 0.64
57 0.58
58 0.55
59 0.54
60 0.55
61 0.52
62 0.53
63 0.58
64 0.57
65 0.57
66 0.62
67 0.64
68 0.65
69 0.69
70 0.75
71 0.72
72 0.74
73 0.76
74 0.75
75 0.68
76 0.64
77 0.58
78 0.58
79 0.6
80 0.57
81 0.53
82 0.46
83 0.45
84 0.4
85 0.38
86 0.27
87 0.21
88 0.21
89 0.2
90 0.2
91 0.17
92 0.16
93 0.15
94 0.15
95 0.14
96 0.11
97 0.09
98 0.07
99 0.06
100 0.05
101 0.05
102 0.05
103 0.05
104 0.05
105 0.05
106 0.06
107 0.07
108 0.08
109 0.08
110 0.08
111 0.1
112 0.11
113 0.11
114 0.1
115 0.1
116 0.1
117 0.09
118 0.1
119 0.09
120 0.07
121 0.07
122 0.06
123 0.06
124 0.08
125 0.09
126 0.09
127 0.14
128 0.17
129 0.28
130 0.36
131 0.39
132 0.42
133 0.48
134 0.53
135 0.56
136 0.64
137 0.6
138 0.62
139 0.6
140 0.6
141 0.54
142 0.48
143 0.42
144 0.32
145 0.3
146 0.22
147 0.22
148 0.2
149 0.21
150 0.21
151 0.2
152 0.23
153 0.21
154 0.2
155 0.21
156 0.2
157 0.18
158 0.19
159 0.19
160 0.17
161 0.18
162 0.21
163 0.21
164 0.25
165 0.23
166 0.22
167 0.24
168 0.24
169 0.24
170 0.21
171 0.18
172 0.14
173 0.16
174 0.16
175 0.14
176 0.11
177 0.09
178 0.08
179 0.08
180 0.07
181 0.06
182 0.07
183 0.07
184 0.06
185 0.07
186 0.07
187 0.07
188 0.07
189 0.06
190 0.07
191 0.07
192 0.07
193 0.08
194 0.09
195 0.11
196 0.13
197 0.15
198 0.15
199 0.16
200 0.17
201 0.17
202 0.16
203 0.13
204 0.14
205 0.17
206 0.15
207 0.16
208 0.17
209 0.19
210 0.21
211 0.22
212 0.25
213 0.28
214 0.36
215 0.41
216 0.43
217 0.45
218 0.44
219 0.46
220 0.45
221 0.41
222 0.35
223 0.34
224 0.38
225 0.38
226 0.44
227 0.49
228 0.51
229 0.5
230 0.51
231 0.51
232 0.46
233 0.43
234 0.37
235 0.31
236 0.26
237 0.26
238 0.26
239 0.22
240 0.2
241 0.19
242 0.19
243 0.18
244 0.18
245 0.15
246 0.13
247 0.13
248 0.17
249 0.21
250 0.19
251 0.18
252 0.17
253 0.19
254 0.19
255 0.16
256 0.12
257 0.08
258 0.09
259 0.09
260 0.09
261 0.07
262 0.06
263 0.09
264 0.13
265 0.14
266 0.14
267 0.16
268 0.18
269 0.24
270 0.26
271 0.26
272 0.27
273 0.33
274 0.37
275 0.36
276 0.36
277 0.31
278 0.3
279 0.27
280 0.24
281 0.22
282 0.19
283 0.22
284 0.27
285 0.26
286 0.26
287 0.27
288 0.26
289 0.23
290 0.26
291 0.28
292 0.31
293 0.38
294 0.4
295 0.39
296 0.39
297 0.42
298 0.42
299 0.44
300 0.4
301 0.35
302 0.35
303 0.38
304 0.39
305 0.4
306 0.47
307 0.45
308 0.48
309 0.57
310 0.64
311 0.71
312 0.8
313 0.86
314 0.85
315 0.9
316 0.88
317 0.84
318 0.84
319 0.77
320 0.73
321 0.69
322 0.58
323 0.49
324 0.45
325 0.41
326 0.31
327 0.28
328 0.22
329 0.2
330 0.2
331 0.2
332 0.24
333 0.25
334 0.26
335 0.26
336 0.33
337 0.36
338 0.38
339 0.38
340 0.38
341 0.38
342 0.41
343 0.4
344 0.35
345 0.31
346 0.31
347 0.33
348 0.36
349 0.33
350 0.33
351 0.34
352 0.33
353 0.3
354 0.27
355 0.24
356 0.16
357 0.15
358 0.12
359 0.11
360 0.09
361 0.09
362 0.08