Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1X2G314

Protein Details
Accession A0A1X2G314    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
71-94MYYEKPNVARRRKNIERNRKLFGAHydrophilic
NLS Segment(s)
PositionSequence
80-90RRRKNIERNRK
Subcellular Location(s) nucl 20, cyto_nucl 12, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001911  Ribosomal_S21  
IPR038380  S21_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01165  Ribosomal_S21  
Amino Acid Sequences MSSMKNSSDSLSQSLPRMLATKYQDSKELSTSLEPYSGRSIGNVSNVNAAYRRLNAILAQNNVRRELRANMYYEKPNVARRRKNIERNRKLFGAMVRKKVALIMQMKQRGM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.25
3 0.22
4 0.21
5 0.18
6 0.22
7 0.25
8 0.31
9 0.34
10 0.35
11 0.39
12 0.4
13 0.41
14 0.37
15 0.33
16 0.26
17 0.23
18 0.23
19 0.19
20 0.19
21 0.17
22 0.16
23 0.18
24 0.17
25 0.16
26 0.14
27 0.15
28 0.13
29 0.17
30 0.17
31 0.14
32 0.16
33 0.16
34 0.16
35 0.15
36 0.15
37 0.12
38 0.11
39 0.12
40 0.09
41 0.09
42 0.1
43 0.14
44 0.16
45 0.17
46 0.2
47 0.22
48 0.23
49 0.25
50 0.24
51 0.21
52 0.19
53 0.22
54 0.23
55 0.23
56 0.25
57 0.26
58 0.3
59 0.32
60 0.31
61 0.3
62 0.28
63 0.33
64 0.39
65 0.46
66 0.5
67 0.55
68 0.64
69 0.7
70 0.79
71 0.81
72 0.84
73 0.85
74 0.82
75 0.81
76 0.72
77 0.63
78 0.57
79 0.53
80 0.53
81 0.49
82 0.51
83 0.48
84 0.46
85 0.45
86 0.43
87 0.38
88 0.34
89 0.32
90 0.32
91 0.38