Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X2GVG7

Protein Details
Accession A0A1X2GVG7   
Localization Confidence Medium
Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
41-64EFYHRIGHMRRRYTRQNNAEQRGIHydrophilic
NLS Segment(s)
PositionSequence
132-139KYKKSKAR
Subcellular Location(s) nucl 17, cyto_nucl 12.333, cyto 5.5, cyto_pero 5.166, pero 3.5
Family & Domain DBs
Amino Acid Sequences MSDLDDEDMEVFKPMGVDPGHSVLFTSMDTNRQCLRLTNPEFYHRIGHMRRRYTRQNNAEQRGINPIMSSLPTKKTVSVPRWMAYCRQLCLCLPSLTNFYGSAFTNDRFLAYVSKQKILDEAVNIFVSGGRKYKKSKARRGVDVDDDENDEGDEDGEDERPNIPLLMLGSGVFGFTRQGKKTRMSIIPKLKAAEKEGRLLVCVVNEAYTSQVCCFCHHRSLSTKRALDPLTNATFGLWAVKYCRVCRTNVNRDKSAATNILHLGLREQEQLDRPAVFCRH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.13
3 0.13
4 0.15
5 0.16
6 0.2
7 0.2
8 0.19
9 0.2
10 0.15
11 0.16
12 0.14
13 0.14
14 0.12
15 0.18
16 0.19
17 0.23
18 0.25
19 0.26
20 0.27
21 0.27
22 0.32
23 0.36
24 0.4
25 0.45
26 0.45
27 0.49
28 0.51
29 0.49
30 0.47
31 0.38
32 0.42
33 0.4
34 0.47
35 0.5
36 0.57
37 0.63
38 0.66
39 0.75
40 0.77
41 0.8
42 0.79
43 0.82
44 0.82
45 0.81
46 0.78
47 0.68
48 0.59
49 0.56
50 0.48
51 0.37
52 0.27
53 0.22
54 0.17
55 0.18
56 0.19
57 0.15
58 0.18
59 0.21
60 0.22
61 0.24
62 0.3
63 0.37
64 0.38
65 0.43
66 0.44
67 0.42
68 0.44
69 0.44
70 0.4
71 0.39
72 0.39
73 0.32
74 0.29
75 0.29
76 0.26
77 0.29
78 0.29
79 0.22
80 0.2
81 0.2
82 0.21
83 0.2
84 0.2
85 0.17
86 0.14
87 0.14
88 0.14
89 0.15
90 0.14
91 0.14
92 0.15
93 0.14
94 0.14
95 0.12
96 0.13
97 0.12
98 0.12
99 0.19
100 0.18
101 0.22
102 0.22
103 0.21
104 0.22
105 0.21
106 0.2
107 0.15
108 0.14
109 0.12
110 0.12
111 0.12
112 0.1
113 0.1
114 0.1
115 0.09
116 0.12
117 0.12
118 0.15
119 0.2
120 0.28
121 0.36
122 0.46
123 0.55
124 0.61
125 0.67
126 0.71
127 0.73
128 0.69
129 0.64
130 0.57
131 0.47
132 0.37
133 0.32
134 0.24
135 0.18
136 0.14
137 0.09
138 0.06
139 0.05
140 0.04
141 0.04
142 0.04
143 0.05
144 0.05
145 0.06
146 0.06
147 0.06
148 0.07
149 0.06
150 0.06
151 0.06
152 0.06
153 0.06
154 0.06
155 0.05
156 0.05
157 0.05
158 0.05
159 0.04
160 0.04
161 0.05
162 0.08
163 0.13
164 0.15
165 0.2
166 0.24
167 0.28
168 0.33
169 0.39
170 0.43
171 0.45
172 0.53
173 0.57
174 0.59
175 0.58
176 0.55
177 0.51
178 0.45
179 0.44
180 0.43
181 0.35
182 0.33
183 0.34
184 0.32
185 0.29
186 0.27
187 0.23
188 0.15
189 0.14
190 0.1
191 0.08
192 0.08
193 0.08
194 0.08
195 0.08
196 0.09
197 0.09
198 0.13
199 0.13
200 0.16
201 0.21
202 0.23
203 0.3
204 0.31
205 0.35
206 0.4
207 0.48
208 0.53
209 0.57
210 0.57
211 0.51
212 0.56
213 0.52
214 0.45
215 0.42
216 0.4
217 0.34
218 0.32
219 0.29
220 0.23
221 0.22
222 0.19
223 0.19
224 0.12
225 0.1
226 0.13
227 0.19
228 0.23
229 0.25
230 0.35
231 0.33
232 0.36
233 0.45
234 0.53
235 0.58
236 0.64
237 0.69
238 0.63
239 0.63
240 0.64
241 0.57
242 0.52
243 0.46
244 0.38
245 0.34
246 0.32
247 0.33
248 0.29
249 0.26
250 0.22
251 0.2
252 0.21
253 0.2
254 0.2
255 0.21
256 0.25
257 0.28
258 0.29
259 0.27
260 0.25