Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X2G3X1

Protein Details
Accession A0A1X2G3X1    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
103-123IFYWATHKKVRPDRWKDSKILHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19, mito_nucl 12.333, cyto_nucl 11.833, mito 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR005631  SDH  
IPR036714  SDH_sf  
IPR028882  SDHAF2  
Gene Ontology GO:0005739  C:mitochondrion  
GO:0018293  P:protein-FAD linkage  
Pfam View protein in Pfam  
PF03937  Sdh5  
Amino Acid Sequences MISTSSVWNAKNDFKYNDPFPNLAIRHSPDMDVETPYPNLPPIPRPNEPKEKKLARLVYQSRKRGILETDLLLSTFSQLYLKDFSMEQLEEYDKLLDEPDWDIFYWATHKKVRPDRWKDSKILDMVCEHSKNKEKKVLRMP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.47
3 0.5
4 0.53
5 0.5
6 0.43
7 0.39
8 0.44
9 0.4
10 0.35
11 0.35
12 0.3
13 0.31
14 0.31
15 0.3
16 0.23
17 0.26
18 0.25
19 0.23
20 0.21
21 0.18
22 0.18
23 0.18
24 0.17
25 0.14
26 0.14
27 0.13
28 0.19
29 0.25
30 0.31
31 0.36
32 0.43
33 0.49
34 0.59
35 0.62
36 0.6
37 0.61
38 0.59
39 0.58
40 0.59
41 0.58
42 0.51
43 0.56
44 0.59
45 0.6
46 0.64
47 0.63
48 0.57
49 0.54
50 0.5
51 0.42
52 0.36
53 0.29
54 0.23
55 0.19
56 0.18
57 0.15
58 0.15
59 0.13
60 0.11
61 0.08
62 0.06
63 0.05
64 0.05
65 0.05
66 0.07
67 0.09
68 0.09
69 0.09
70 0.09
71 0.1
72 0.12
73 0.12
74 0.1
75 0.1
76 0.11
77 0.1
78 0.11
79 0.11
80 0.08
81 0.08
82 0.09
83 0.07
84 0.07
85 0.08
86 0.09
87 0.1
88 0.1
89 0.1
90 0.1
91 0.1
92 0.14
93 0.15
94 0.19
95 0.23
96 0.28
97 0.37
98 0.47
99 0.57
100 0.63
101 0.69
102 0.76
103 0.81
104 0.82
105 0.77
106 0.73
107 0.69
108 0.63
109 0.55
110 0.47
111 0.38
112 0.37
113 0.39
114 0.37
115 0.31
116 0.35
117 0.43
118 0.47
119 0.52
120 0.58
121 0.58