Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1X2G740

Protein Details
Accession A0A1X2G740    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
35-60RGRARGSKSWHNPRHPRPPRHPIKDTBasic
NLS Segment(s)
PositionSequence
25-81QRPPFRGGRGRGRARGSKSWHNPRHPRPPRHPIKDTKSFIRPTFPRIHGSPLNRKQK
Subcellular Location(s) nucl 17.5, cyto_nucl 11.833, mito_nucl 11.666, mito 4.5
Family & Domain DBs
Amino Acid Sequences MADGPSPPGAAGSYPSSSSTNWRPQRPPFRGGRGRGRARGSKSWHNPRHPRPPRHPIKDTKSFIRPTFPRIHGSPLNRKQKKSAITNHRQLVPMSLI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.17
3 0.18
4 0.18
5 0.24
6 0.28
7 0.35
8 0.41
9 0.47
10 0.51
11 0.59
12 0.69
13 0.69
14 0.68
15 0.65
16 0.68
17 0.69
18 0.7
19 0.7
20 0.69
21 0.69
22 0.68
23 0.66
24 0.62
25 0.6
26 0.6
27 0.56
28 0.56
29 0.6
30 0.65
31 0.67
32 0.7
33 0.74
34 0.75
35 0.8
36 0.8
37 0.79
38 0.77
39 0.8
40 0.81
41 0.8
42 0.79
43 0.77
44 0.75
45 0.77
46 0.72
47 0.67
48 0.64
49 0.6
50 0.54
51 0.54
52 0.47
53 0.43
54 0.48
55 0.45
56 0.43
57 0.4
58 0.46
59 0.43
60 0.49
61 0.54
62 0.55
63 0.64
64 0.65
65 0.65
66 0.65
67 0.67
68 0.68
69 0.66
70 0.67
71 0.67
72 0.71
73 0.78
74 0.77
75 0.74
76 0.67
77 0.59