Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X2GJQ3

Protein Details
Accession A0A1X2GJQ3    Localization Confidence Low Confidence Score 6.9
NoLS Segment(s)
PositionSequenceProtein Nature
6-33IPKTRNTFCKGVKCRKHTPHKVTQYKAGHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 15, nucl 6.5, cyto_nucl 6.5, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000552  Ribosomal_L44e  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00935  Ribosomal_L44  
PROSITE View protein in PROSITE  
PS01172  RIBOSOMAL_L44E  
Amino Acid Sequences MVIVNIPKTRNTFCKGVKCRKHTPHKVTQYKAGKASLFAQGKRRYDRKQSGYGGQTKPVFHKKAKTTKKIVLRLECTKCKYKMQLPIKRCKHFELGGDKKTKGAALVF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.63
3 0.69
4 0.74
5 0.75
6 0.8
7 0.83
8 0.87
9 0.86
10 0.85
11 0.85
12 0.87
13 0.88
14 0.8
15 0.8
16 0.77
17 0.7
18 0.65
19 0.57
20 0.46
21 0.38
22 0.37
23 0.36
24 0.31
25 0.29
26 0.34
27 0.38
28 0.42
29 0.47
30 0.51
31 0.48
32 0.54
33 0.61
34 0.59
35 0.6
36 0.59
37 0.58
38 0.56
39 0.58
40 0.49
41 0.44
42 0.4
43 0.33
44 0.35
45 0.36
46 0.35
47 0.3
48 0.37
49 0.41
50 0.5
51 0.59
52 0.62
53 0.61
54 0.65
55 0.72
56 0.72
57 0.71
58 0.67
59 0.65
60 0.66
61 0.67
62 0.66
63 0.62
64 0.61
65 0.57
66 0.55
67 0.55
68 0.53
69 0.56
70 0.6
71 0.65
72 0.66
73 0.74
74 0.78
75 0.78
76 0.75
77 0.69
78 0.65
79 0.6
80 0.59
81 0.59
82 0.59
83 0.59
84 0.61
85 0.57
86 0.51
87 0.48
88 0.42