Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1X2GQZ5

Protein Details
Accession A0A1X2GQZ5    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MANGDKNRKDRRRDLMKSIPVHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 9, mito 6, E.R. 4, golg 4, extr 3, mito_nucl 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MANGDKNRKDRRRDLMKSIPVVLIIVISSITYNISSYCKPSRRHPFMLEHRKEVSAETCYIIDFQICQQQSRRLSLCRRLWPCLLFYPDVIDRLPLIL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.8
3 0.79
4 0.73
5 0.66
6 0.56
7 0.45
8 0.38
9 0.28
10 0.18
11 0.1
12 0.07
13 0.04
14 0.04
15 0.04
16 0.04
17 0.04
18 0.04
19 0.05
20 0.06
21 0.08
22 0.09
23 0.13
24 0.21
25 0.27
26 0.3
27 0.39
28 0.49
29 0.54
30 0.59
31 0.59
32 0.61
33 0.65
34 0.73
35 0.66
36 0.59
37 0.53
38 0.48
39 0.44
40 0.35
41 0.27
42 0.18
43 0.16
44 0.14
45 0.12
46 0.12
47 0.12
48 0.11
49 0.08
50 0.07
51 0.07
52 0.13
53 0.13
54 0.15
55 0.17
56 0.25
57 0.28
58 0.33
59 0.35
60 0.36
61 0.43
62 0.51
63 0.57
64 0.59
65 0.61
66 0.6
67 0.62
68 0.57
69 0.53
70 0.5
71 0.46
72 0.38
73 0.33
74 0.34
75 0.31
76 0.31
77 0.27
78 0.22