Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X2GB71

Protein Details
Accession A0A1X2GB71    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
69-96KFLGRKFSFWRKLPKKKRERSDVFRFICHydrophilic
NLS Segment(s)
PositionSequence
78-87WRKLPKKKRE
Subcellular Location(s) nucl 18.5, cyto_nucl 13.5, cyto 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR037652  Mim2  
Gene Ontology GO:0005739  C:mitochondrion  
GO:0070096  P:mitochondrial outer membrane translocase complex assembly  
GO:0045040  P:protein insertion into mitochondrial outer membrane  
Pfam View protein in Pfam  
PF19117  Mim2  
Amino Acid Sequences MSTADDKTQESEFLREPEDYNIDTIDDAPDGYYDDDDSDYSYDAEAEWEESKAQMQALFSMVVFPYLGKFLGRKFSFWRKLPKKKRERSDVFRFICSFQCGPAILNRQGHGKPLLC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.24
3 0.24
4 0.24
5 0.26
6 0.22
7 0.2
8 0.18
9 0.16
10 0.15
11 0.14
12 0.11
13 0.08
14 0.07
15 0.06
16 0.06
17 0.07
18 0.07
19 0.07
20 0.06
21 0.07
22 0.07
23 0.07
24 0.08
25 0.07
26 0.08
27 0.07
28 0.07
29 0.06
30 0.06
31 0.06
32 0.05
33 0.06
34 0.06
35 0.07
36 0.07
37 0.07
38 0.07
39 0.07
40 0.07
41 0.06
42 0.06
43 0.06
44 0.07
45 0.07
46 0.06
47 0.07
48 0.06
49 0.05
50 0.05
51 0.05
52 0.04
53 0.05
54 0.05
55 0.05
56 0.06
57 0.07
58 0.17
59 0.17
60 0.19
61 0.25
62 0.35
63 0.43
64 0.47
65 0.57
66 0.59
67 0.69
68 0.78
69 0.83
70 0.84
71 0.86
72 0.91
73 0.91
74 0.9
75 0.88
76 0.88
77 0.87
78 0.79
79 0.74
80 0.66
81 0.57
82 0.51
83 0.46
84 0.36
85 0.26
86 0.25
87 0.21
88 0.21
89 0.26
90 0.29
91 0.29
92 0.32
93 0.33
94 0.36
95 0.36
96 0.4