Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X2GQP8

Protein Details
Accession A0A1X2GQP8   
Localization Confidence Low
Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
118-140AMGKYDDNKKKKRDDDNGNDEPPAcidic
NLS Segment(s)
Subcellular Location(s) nucl 14.5, mito_nucl 12, mito 8.5, cyto 3
Family & Domain DBs
Amino Acid Sequences MSYYVTDPLKNYSFIITKGKVNTASPSNQTAGTTSAEQSSANQPALEPSSETVYNMGQAVDRVVDQAEAMAKRTQKLSKDILHTWQDGKVLGTWLNDTKYKETMFILKDRVTKMVDVAMGKYDDNKKKKRDDDNGNDEPPPSSPPQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.33
3 0.29
4 0.31
5 0.33
6 0.36
7 0.34
8 0.33
9 0.35
10 0.32
11 0.34
12 0.32
13 0.33
14 0.3
15 0.29
16 0.27
17 0.23
18 0.21
19 0.19
20 0.17
21 0.14
22 0.14
23 0.13
24 0.13
25 0.14
26 0.17
27 0.17
28 0.16
29 0.15
30 0.14
31 0.16
32 0.18
33 0.16
34 0.12
35 0.1
36 0.13
37 0.13
38 0.13
39 0.12
40 0.1
41 0.1
42 0.1
43 0.09
44 0.06
45 0.06
46 0.06
47 0.05
48 0.05
49 0.05
50 0.05
51 0.05
52 0.04
53 0.04
54 0.07
55 0.06
56 0.08
57 0.1
58 0.11
59 0.12
60 0.15
61 0.18
62 0.18
63 0.22
64 0.26
65 0.28
66 0.33
67 0.33
68 0.36
69 0.36
70 0.35
71 0.32
72 0.28
73 0.24
74 0.19
75 0.18
76 0.13
77 0.11
78 0.11
79 0.11
80 0.11
81 0.12
82 0.14
83 0.17
84 0.18
85 0.19
86 0.21
87 0.21
88 0.21
89 0.2
90 0.24
91 0.23
92 0.25
93 0.26
94 0.27
95 0.31
96 0.3
97 0.32
98 0.28
99 0.25
100 0.23
101 0.21
102 0.2
103 0.17
104 0.17
105 0.16
106 0.16
107 0.15
108 0.2
109 0.27
110 0.34
111 0.42
112 0.5
113 0.55
114 0.64
115 0.73
116 0.78
117 0.79
118 0.81
119 0.83
120 0.84
121 0.84
122 0.77
123 0.69
124 0.59
125 0.5
126 0.4