Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1X2G789

Protein Details
Accession A0A1X2G789    Localization Confidence Medium Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
45-68RMTKKNGRRVIARRRMKGRRFLSHBasic
NLS Segment(s)
PositionSequence
36-65RKRRHGFLARMTKKNGRRVIARRRMKGRRF
Subcellular Location(s) nucl 21, mito_nucl 13.333, cyto_nucl 11.833, mito 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000271  Ribosomal_L34  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00468  Ribosomal_L34  
Amino Acid Sequences SLPSSSLFRPPQNPFQNLQMRMVTYGNTYQPSNLVRKRRHGFLARMTKKNGRRVIARRRMKGRRFLSH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.57
3 0.61
4 0.55
5 0.52
6 0.43
7 0.36
8 0.34
9 0.32
10 0.23
11 0.16
12 0.16
13 0.15
14 0.15
15 0.14
16 0.12
17 0.15
18 0.16
19 0.21
20 0.25
21 0.31
22 0.33
23 0.42
24 0.45
25 0.47
26 0.51
27 0.51
28 0.51
29 0.52
30 0.61
31 0.58
32 0.59
33 0.6
34 0.62
35 0.62
36 0.67
37 0.63
38 0.57
39 0.59
40 0.64
41 0.71
42 0.73
43 0.76
44 0.76
45 0.8
46 0.86
47 0.84
48 0.85