Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X2G3M3

Protein Details
Accession A0A1X2G3M3    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
1-25MANEDKNRKDRRREIYKPRKSIPVVHydrophilic
NLS Segment(s)
PositionSequence
9-14KDRRRE
Subcellular Location(s) mito 7, plas 6, extr 5, E.R. 4, mito_nucl 4
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MANEDKNRKDRRREIYKPRKSIPVVLIIVISSITLNAARSIPMTLQERQRESASLNMPPHTPPPHDSQAPQHDQWAFVSSVFSFTRKALG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.88
3 0.9
4 0.88
5 0.83
6 0.81
7 0.72
8 0.69
9 0.6
10 0.57
11 0.48
12 0.39
13 0.35
14 0.26
15 0.24
16 0.17
17 0.13
18 0.05
19 0.04
20 0.04
21 0.04
22 0.04
23 0.05
24 0.05
25 0.06
26 0.06
27 0.07
28 0.07
29 0.1
30 0.13
31 0.15
32 0.21
33 0.24
34 0.26
35 0.27
36 0.28
37 0.25
38 0.23
39 0.25
40 0.22
41 0.23
42 0.23
43 0.22
44 0.22
45 0.23
46 0.26
47 0.23
48 0.23
49 0.21
50 0.27
51 0.32
52 0.33
53 0.34
54 0.38
55 0.44
56 0.48
57 0.46
58 0.43
59 0.38
60 0.37
61 0.36
62 0.31
63 0.23
64 0.17
65 0.18
66 0.13
67 0.17
68 0.17
69 0.17
70 0.15