Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X2GI69

Protein Details
Accession A0A1X2GI69   
Localization Confidence Medium
Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
4-33QERRQRNKTASAKYRQKKNRQQLEMKRTIDHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 24, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004827  bZIP  
IPR046347  bZIP_sf  
Gene Ontology GO:0003700  F:DNA-binding transcription factor activity  
PROSITE View protein in PROSITE  
PS50217  BZIP  
PS00036  BZIP_BASIC  
Amino Acid Sequences LSLQERRQRNKTASAKYRQKKNRQQLEMKRTIDALTEQDALLKRQVTELRIENQRLRVMNDHLRSKILAKKMLDQYLERHHQPQPPSIP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.8
3 0.8
4 0.86
5 0.85
6 0.87
7 0.87
8 0.88
9 0.88
10 0.86
11 0.89
12 0.88
13 0.88
14 0.87
15 0.77
16 0.67
17 0.57
18 0.48
19 0.38
20 0.29
21 0.21
22 0.14
23 0.13
24 0.12
25 0.14
26 0.14
27 0.14
28 0.15
29 0.13
30 0.11
31 0.13
32 0.15
33 0.13
34 0.16
35 0.18
36 0.22
37 0.26
38 0.28
39 0.28
40 0.29
41 0.32
42 0.29
43 0.29
44 0.27
45 0.29
46 0.34
47 0.37
48 0.38
49 0.35
50 0.35
51 0.34
52 0.34
53 0.35
54 0.32
55 0.33
56 0.31
57 0.38
58 0.44
59 0.48
60 0.47
61 0.43
62 0.43
63 0.46
64 0.5
65 0.45
66 0.42
67 0.42
68 0.46
69 0.47