Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1X2GE26

Protein Details
Accession A0A1X2GE26    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
78-105RYGLHHRKSLHKVPKFTKKTQRTSPPGFHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 23, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFGPFRPSFVAQGGLLWKNPFRMSATRKANVRKRLRQVDDVIATIQASGVRCKALDQAAALPKESEMLPRDKYTVFSRYGLHHRKSLHKVPKFTKKTQRTSPPGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.23
3 0.22
4 0.21
5 0.21
6 0.22
7 0.21
8 0.2
9 0.27
10 0.32
11 0.4
12 0.46
13 0.48
14 0.54
15 0.62
16 0.66
17 0.68
18 0.72
19 0.71
20 0.73
21 0.78
22 0.77
23 0.73
24 0.69
25 0.65
26 0.56
27 0.48
28 0.38
29 0.28
30 0.23
31 0.17
32 0.13
33 0.08
34 0.07
35 0.07
36 0.07
37 0.07
38 0.07
39 0.08
40 0.09
41 0.09
42 0.09
43 0.09
44 0.13
45 0.17
46 0.18
47 0.17
48 0.15
49 0.14
50 0.15
51 0.14
52 0.13
53 0.11
54 0.15
55 0.17
56 0.18
57 0.2
58 0.2
59 0.23
60 0.24
61 0.26
62 0.24
63 0.24
64 0.25
65 0.28
66 0.38
67 0.43
68 0.42
69 0.42
70 0.44
71 0.51
72 0.58
73 0.63
74 0.63
75 0.62
76 0.68
77 0.73
78 0.8
79 0.79
80 0.8
81 0.81
82 0.81
83 0.83
84 0.84
85 0.86