Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X2GFA8

Protein Details
Accession A0A1X2GFA8    Localization Confidence Low Confidence Score 8.3
NoLS Segment(s)
PositionSequenceProtein Nature
51-80LDEKKQKQKTTKPTNRTYHRKRNRDAIKAAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13mito 13mito_nucl 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR013870  Ribosomal_L37_mit  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF08561  Ribosomal_L37  
Amino Acid Sequences MTTLGTSTQPSRKASSTPAGTVLKGINFLKDGKDPVALEDDQYPMWLWDLLDEKKQKQKTTKPTNRTYHRKRNRDAIKAANFMSDKKT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.42
3 0.4
4 0.36
5 0.39
6 0.36
7 0.34
8 0.33
9 0.29
10 0.21
11 0.2
12 0.19
13 0.14
14 0.14
15 0.15
16 0.15
17 0.16
18 0.17
19 0.14
20 0.17
21 0.16
22 0.15
23 0.18
24 0.16
25 0.15
26 0.14
27 0.14
28 0.11
29 0.12
30 0.1
31 0.07
32 0.07
33 0.07
34 0.05
35 0.06
36 0.1
37 0.11
38 0.17
39 0.2
40 0.23
41 0.3
42 0.35
43 0.38
44 0.43
45 0.52
46 0.57
47 0.66
48 0.73
49 0.74
50 0.8
51 0.85
52 0.86
53 0.88
54 0.87
55 0.87
56 0.88
57 0.88
58 0.84
59 0.85
60 0.84
61 0.82
62 0.79
63 0.78
64 0.74
65 0.69
66 0.64
67 0.6
68 0.51