Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X2G8Y8

Protein Details
Accession A0A1X2G8Y8   
Localization Confidence Medium
Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
93-112IPQVASAKSTNKKKKKRGGKHydrophilic
NLS Segment(s)
PositionSequence
102-112TNKKKKKRGGK
Subcellular Location(s) nucl 20.5, cyto_nucl 14.833, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR009018  Signal_recog_particle_SRP9/14  
IPR039914  SRP9-like  
IPR039432  SRP9_dom  
Gene Ontology GO:0048500  C:signal recognition particle  
GO:0008312  F:7S RNA binding  
GO:0006614  P:SRP-dependent cotranslational protein targeting to membrane  
Pfam View protein in Pfam  
PF05486  SRP9-21  
Amino Acid Sequences MYINNWDDFQKAAEDIYTSSPDTTRYVHSFHGADGQLVLKVTNDQTVVMYKTDQASDLKKFIGLNTLLMSQMQNRSLEPEAVNTPPAQPSPQIPQVASAKSTNKKKKKRGGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.12
3 0.14
4 0.15
5 0.14
6 0.14
7 0.14
8 0.16
9 0.17
10 0.17
11 0.19
12 0.2
13 0.21
14 0.22
15 0.25
16 0.24
17 0.22
18 0.26
19 0.21
20 0.18
21 0.17
22 0.16
23 0.13
24 0.12
25 0.12
26 0.06
27 0.07
28 0.07
29 0.08
30 0.08
31 0.08
32 0.08
33 0.1
34 0.11
35 0.1
36 0.1
37 0.09
38 0.1
39 0.1
40 0.1
41 0.1
42 0.12
43 0.13
44 0.14
45 0.13
46 0.13
47 0.13
48 0.12
49 0.15
50 0.13
51 0.12
52 0.12
53 0.12
54 0.11
55 0.12
56 0.12
57 0.09
58 0.11
59 0.12
60 0.12
61 0.11
62 0.15
63 0.16
64 0.18
65 0.16
66 0.17
67 0.17
68 0.18
69 0.19
70 0.15
71 0.15
72 0.15
73 0.16
74 0.14
75 0.13
76 0.16
77 0.22
78 0.28
79 0.29
80 0.27
81 0.32
82 0.35
83 0.36
84 0.35
85 0.32
86 0.34
87 0.4
88 0.51
89 0.57
90 0.63
91 0.71
92 0.79