Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X2GQ68

Protein Details
Accession A0A1X2GQ68    Localization Confidence Medium Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
91-122QSKNNKKAAKIAKQKARRAKRAKEKYGAPQTDHydrophilic
NLS Segment(s)
PositionSequence
93-115KNNKKAAKIAKQKARRAKRAKEK
Subcellular Location(s) mito 15, nucl 9, cyto_nucl 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR000352  Pep_chain_release_fac_I  
IPR045853  Pep_chain_release_fac_I_sf  
Gene Ontology GO:0005739  C:mitochondrion  
GO:0003747  F:translation release factor activity  
Pfam View protein in Pfam  
PF00472  RF-1  
Amino Acid Sequences MPAVRPLLQLFSTKPERKKIVLQAEDLVETFVKGSGPGGQCINKRSSCVDLRHIPTGIRVQCQQTRSLQENRGIARKLLKEKLDDLVNGAQSKNNKKAAKIAKQKARRAKRAKEKYGAPQTDHSPASSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.5
3 0.53
4 0.54
5 0.61
6 0.63
7 0.63
8 0.6
9 0.57
10 0.52
11 0.48
12 0.45
13 0.36
14 0.28
15 0.17
16 0.13
17 0.1
18 0.08
19 0.06
20 0.05
21 0.06
22 0.11
23 0.12
24 0.14
25 0.16
26 0.2
27 0.22
28 0.26
29 0.3
30 0.25
31 0.25
32 0.26
33 0.29
34 0.31
35 0.32
36 0.35
37 0.36
38 0.39
39 0.4
40 0.38
41 0.33
42 0.29
43 0.32
44 0.28
45 0.23
46 0.21
47 0.23
48 0.25
49 0.27
50 0.26
51 0.23
52 0.26
53 0.29
54 0.32
55 0.31
56 0.32
57 0.34
58 0.34
59 0.36
60 0.32
61 0.28
62 0.29
63 0.3
64 0.32
65 0.34
66 0.34
67 0.31
68 0.32
69 0.35
70 0.32
71 0.27
72 0.24
73 0.22
74 0.22
75 0.21
76 0.19
77 0.18
78 0.21
79 0.27
80 0.31
81 0.37
82 0.36
83 0.36
84 0.46
85 0.53
86 0.58
87 0.63
88 0.66
89 0.68
90 0.76
91 0.84
92 0.85
93 0.85
94 0.86
95 0.85
96 0.86
97 0.88
98 0.89
99 0.89
100 0.87
101 0.83
102 0.83
103 0.84
104 0.78
105 0.71
106 0.65
107 0.61
108 0.59
109 0.53