Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X2GJR2

Protein Details
Accession A0A1X2GJR2    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
259-284NDLCPSSTVKKKRAPKIKQEEPMAQEHydrophilic
NLS Segment(s)
PositionSequence
17-38IKSEKRSAPVKKESAPRTKKMK
269-272KKRA
Subcellular Location(s) mito 22.5, cyto_mito 12, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR011257  DNA_glycosylase  
IPR003651  Endonuclease3_FeS-loop_motif  
IPR003265  HhH-GPD_domain  
IPR023170  HhH_base_excis_C  
IPR000445  HhH_motif  
IPR030841  NTH1  
Gene Ontology GO:0005739  C:mitochondrion  
GO:0005634  C:nucleus  
GO:0051539  F:4 iron, 4 sulfur cluster binding  
GO:0140078  F:class I DNA-(apurinic or apyrimidinic site) endonuclease activity  
GO:0003677  F:DNA binding  
GO:0046872  F:metal ion binding  
GO:0000703  F:oxidized pyrimidine nucleobase lesion DNA N-glycosylase activity  
GO:0006285  P:base-excision repair, AP site formation  
Pfam View protein in Pfam  
PF00633  HHH  
PF00730  HhH-GPD  
CDD cd00056  ENDO3c  
Amino Acid Sequences MKTRSARVVSSAIPKTIKSEKRSAPVKKESAPRTKKMKTEAGAPGQPPPTWKDVFDKIKHYRQHHPAVVDTMGCAQLAERDKPLKQQRYQTLVALMLSSQTKDTVTSVVVKRLQTDLPGGLSIASILAIDEHALDIMIHSVGFHTRKAGYIKQTAQILHDQYNDDIPDSIEGLTSLPGVGPKMGYLALQSAWHKNMGIGVDVHVHRISNRLGWRPEDTRLCLQSWLPKEHWNEINPILVGYGQSLCLPRGPKCQECPVNDLCPSSTVKKKRAPKIKQEEPMAQELVVKREDSVTIKNEPVEW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.38
3 0.44
4 0.47
5 0.44
6 0.51
7 0.53
8 0.61
9 0.7
10 0.73
11 0.73
12 0.75
13 0.75
14 0.73
15 0.76
16 0.76
17 0.77
18 0.76
19 0.75
20 0.75
21 0.75
22 0.74
23 0.72
24 0.71
25 0.63
26 0.63
27 0.63
28 0.61
29 0.59
30 0.54
31 0.52
32 0.46
33 0.44
34 0.37
35 0.33
36 0.31
37 0.27
38 0.28
39 0.29
40 0.36
41 0.44
42 0.46
43 0.52
44 0.54
45 0.61
46 0.67
47 0.66
48 0.67
49 0.66
50 0.71
51 0.66
52 0.61
53 0.55
54 0.51
55 0.46
56 0.36
57 0.28
58 0.2
59 0.16
60 0.13
61 0.1
62 0.07
63 0.12
64 0.15
65 0.16
66 0.19
67 0.22
68 0.23
69 0.33
70 0.43
71 0.46
72 0.48
73 0.55
74 0.6
75 0.63
76 0.64
77 0.56
78 0.48
79 0.4
80 0.35
81 0.25
82 0.17
83 0.12
84 0.11
85 0.1
86 0.08
87 0.07
88 0.07
89 0.08
90 0.09
91 0.08
92 0.08
93 0.15
94 0.15
95 0.2
96 0.24
97 0.23
98 0.24
99 0.25
100 0.24
101 0.19
102 0.2
103 0.15
104 0.12
105 0.12
106 0.11
107 0.08
108 0.08
109 0.06
110 0.05
111 0.04
112 0.03
113 0.03
114 0.03
115 0.02
116 0.03
117 0.03
118 0.03
119 0.03
120 0.03
121 0.03
122 0.03
123 0.03
124 0.03
125 0.03
126 0.03
127 0.03
128 0.06
129 0.07
130 0.07
131 0.08
132 0.08
133 0.11
134 0.15
135 0.18
136 0.2
137 0.24
138 0.26
139 0.27
140 0.29
141 0.27
142 0.25
143 0.25
144 0.23
145 0.19
146 0.19
147 0.17
148 0.15
149 0.16
150 0.15
151 0.12
152 0.1
153 0.08
154 0.07
155 0.07
156 0.07
157 0.05
158 0.05
159 0.05
160 0.05
161 0.05
162 0.04
163 0.04
164 0.04
165 0.05
166 0.05
167 0.04
168 0.04
169 0.05
170 0.05
171 0.05
172 0.05
173 0.06
174 0.06
175 0.09
176 0.11
177 0.12
178 0.13
179 0.14
180 0.13
181 0.12
182 0.14
183 0.12
184 0.11
185 0.09
186 0.09
187 0.13
188 0.13
189 0.15
190 0.13
191 0.13
192 0.12
193 0.15
194 0.15
195 0.16
196 0.2
197 0.25
198 0.27
199 0.3
200 0.35
201 0.35
202 0.4
203 0.39
204 0.4
205 0.4
206 0.4
207 0.38
208 0.34
209 0.33
210 0.34
211 0.35
212 0.35
213 0.31
214 0.35
215 0.38
216 0.43
217 0.47
218 0.41
219 0.4
220 0.36
221 0.38
222 0.31
223 0.27
224 0.2
225 0.15
226 0.14
227 0.11
228 0.1
229 0.07
230 0.08
231 0.1
232 0.1
233 0.13
234 0.16
235 0.18
236 0.28
237 0.34
238 0.39
239 0.44
240 0.53
241 0.57
242 0.58
243 0.61
244 0.57
245 0.55
246 0.51
247 0.47
248 0.37
249 0.32
250 0.33
251 0.32
252 0.36
253 0.39
254 0.46
255 0.53
256 0.62
257 0.7
258 0.77
259 0.8
260 0.82
261 0.85
262 0.87
263 0.87
264 0.84
265 0.82
266 0.75
267 0.71
268 0.61
269 0.5
270 0.44
271 0.38
272 0.34
273 0.28
274 0.24
275 0.19
276 0.2
277 0.23
278 0.23
279 0.26
280 0.27
281 0.3
282 0.32