Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X2G4J2

Protein Details
Accession A0A1X2G4J2    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
5-33GKAPAKTTEKKAKGDKKRKATRKETYSSYHydrophilic
NLS Segment(s)
PositionSequence
6-27KAPAKTTEKKAKGDKKRKATRK
Subcellular Location(s) nucl 22, cyto_nucl 14, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR009072  Histone-fold  
IPR007125  Histone_H2A/H2B/H3  
IPR000558  Histone_H2B  
Gene Ontology GO:0000786  C:nucleosome  
GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0046982  F:protein heterodimerization activity  
GO:0030527  F:structural constituent of chromatin  
Pfam View protein in Pfam  
PF00125  Histone  
PROSITE View protein in PROSITE  
PS00357  HISTONE_H2B  
Amino Acid Sequences MAPAGKAPAKTTEKKAKGDKKRKATRKETYSSYIYKVLKQVHPDTGISNKAMSILNSFVNDIFERIATEASKLAAYNKRSTISSREIQTAVRLILPGELAKHAVSEGTKAVTKYTSSK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.71
3 0.73
4 0.77
5 0.82
6 0.83
7 0.83
8 0.88
9 0.9
10 0.9
11 0.9
12 0.89
13 0.87
14 0.83
15 0.77
16 0.72
17 0.67
18 0.59
19 0.52
20 0.48
21 0.41
22 0.37
23 0.36
24 0.36
25 0.34
26 0.37
27 0.37
28 0.34
29 0.35
30 0.33
31 0.3
32 0.27
33 0.26
34 0.21
35 0.18
36 0.14
37 0.13
38 0.13
39 0.11
40 0.1
41 0.09
42 0.1
43 0.1
44 0.1
45 0.08
46 0.09
47 0.09
48 0.08
49 0.07
50 0.06
51 0.06
52 0.06
53 0.07
54 0.06
55 0.07
56 0.07
57 0.07
58 0.07
59 0.07
60 0.11
61 0.16
62 0.19
63 0.22
64 0.24
65 0.25
66 0.26
67 0.29
68 0.3
69 0.31
70 0.33
71 0.31
72 0.32
73 0.31
74 0.31
75 0.3
76 0.27
77 0.21
78 0.17
79 0.14
80 0.11
81 0.11
82 0.12
83 0.1
84 0.09
85 0.09
86 0.1
87 0.1
88 0.1
89 0.09
90 0.1
91 0.1
92 0.11
93 0.11
94 0.13
95 0.16
96 0.16
97 0.18
98 0.18