Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X2GW91

Protein Details
Accession A0A1X2GW91    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
2-28GHALSMWLRSRKRKEQQHRRDNFEDRGHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17, mito 6, cyto 4
Family & Domain DBs
Amino Acid Sequences RGHALSMWLRSRKRKEQQHRRDNFEDRGVNGPHDGYTVEELVKASKYYFELGSGEAICDRMMFLMQHTMLLRGQTTRALELADLVDLEFEGEGPT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.77
2 0.81
3 0.85
4 0.9
5 0.91
6 0.9
7 0.88
8 0.86
9 0.81
10 0.75
11 0.71
12 0.62
13 0.53
14 0.5
15 0.42
16 0.35
17 0.29
18 0.25
19 0.17
20 0.15
21 0.13
22 0.08
23 0.09
24 0.09
25 0.08
26 0.08
27 0.08
28 0.08
29 0.09
30 0.08
31 0.06
32 0.07
33 0.08
34 0.09
35 0.09
36 0.09
37 0.09
38 0.09
39 0.1
40 0.09
41 0.08
42 0.07
43 0.07
44 0.06
45 0.06
46 0.05
47 0.04
48 0.05
49 0.05
50 0.05
51 0.09
52 0.09
53 0.11
54 0.12
55 0.13
56 0.13
57 0.14
58 0.14
59 0.11
60 0.12
61 0.13
62 0.15
63 0.14
64 0.14
65 0.14
66 0.13
67 0.13
68 0.13
69 0.1
70 0.08
71 0.07
72 0.07
73 0.06
74 0.06
75 0.05