Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X2GP71

Protein Details
Accession A0A1X2GP71   
Localization Confidence Medium
Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
22-51INLHQCKRPFKNPKYHTPKKWKNLKQVLTLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 22, cyto_nucl 14, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR029525  INO80C/Ies6  
IPR013272  Vps72/YL1_C  
Gene Ontology GO:0031011  C:Ino80 complex  
GO:0006338  P:chromatin remodeling  
Pfam View protein in Pfam  
PF08265  YL1_C  
Amino Acid Sequences MAPKRGKKSNQNDDENGELTVINLHQCKRPFKNPKYHTPKKWKNLKQVLTLEKTQDFDLDIPTYQSIECPPSVRPQKKYCDITGLEAKYTDPKTGLRYHNNEIYKVIRTLGVPGVQAYLANRNAAVILK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.67
2 0.58
3 0.47
4 0.36
5 0.26
6 0.18
7 0.16
8 0.12
9 0.11
10 0.13
11 0.14
12 0.19
13 0.24
14 0.33
15 0.38
16 0.48
17 0.56
18 0.62
19 0.71
20 0.73
21 0.79
22 0.81
23 0.84
24 0.84
25 0.84
26 0.86
27 0.84
28 0.89
29 0.86
30 0.86
31 0.87
32 0.82
33 0.79
34 0.76
35 0.72
36 0.65
37 0.58
38 0.5
39 0.41
40 0.36
41 0.28
42 0.21
43 0.15
44 0.12
45 0.12
46 0.1
47 0.09
48 0.08
49 0.08
50 0.08
51 0.07
52 0.07
53 0.06
54 0.07
55 0.08
56 0.08
57 0.09
58 0.18
59 0.28
60 0.33
61 0.38
62 0.43
63 0.5
64 0.57
65 0.6
66 0.53
67 0.5
68 0.46
69 0.45
70 0.45
71 0.39
72 0.31
73 0.27
74 0.26
75 0.25
76 0.25
77 0.21
78 0.15
79 0.16
80 0.2
81 0.28
82 0.34
83 0.37
84 0.42
85 0.46
86 0.53
87 0.53
88 0.5
89 0.45
90 0.41
91 0.35
92 0.3
93 0.26
94 0.2
95 0.18
96 0.2
97 0.21
98 0.2
99 0.17
100 0.17
101 0.17
102 0.15
103 0.16
104 0.14
105 0.17
106 0.17
107 0.17
108 0.16
109 0.16