Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1X2GFS6

Protein Details
Accession A0A1X2GFS6    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
23-44DSDDNKKPGKRNGRRKIKIEYIBasic
NLS Segment(s)
PositionSequence
28-59KKPGKRNGRRKIKIEYIEDKTKRHITFSKRKA
Subcellular Location(s) nucl 18.5, cyto_nucl 12.833, cyto 6, cyto_pero 4.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR033897  MADS_SRF-like  
IPR002100  TF_MADSbox  
IPR036879  TF_MADSbox_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0000987  F:cis-regulatory region sequence-specific DNA binding  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0046983  F:protein dimerization activity  
GO:0045944  P:positive regulation of transcription by RNA polymerase II  
Pfam View protein in Pfam  
PF00319  SRF-TF  
PROSITE View protein in PROSITE  
PS00350  MADS_BOX_1  
PS50066  MADS_BOX_2  
CDD cd00266  MADS_SRF_like  
Amino Acid Sequences MNTLQDHIGTDHVDDSLTAEDDDSDDNKKPGKRNGRRKIKIEYIEDKTKRHITFSKRKAGIMKKAYELSTLTGTQVLLLVVSETGLVYTFTTPKLQPLVTQPEGKNLIQTCLNAPDNQETVE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.1
3 0.1
4 0.1
5 0.09
6 0.08
7 0.08
8 0.09
9 0.11
10 0.1
11 0.12
12 0.13
13 0.14
14 0.19
15 0.23
16 0.28
17 0.36
18 0.46
19 0.54
20 0.64
21 0.73
22 0.8
23 0.83
24 0.83
25 0.82
26 0.79
27 0.76
28 0.71
29 0.68
30 0.63
31 0.65
32 0.62
33 0.55
34 0.51
35 0.51
36 0.44
37 0.41
38 0.4
39 0.4
40 0.48
41 0.54
42 0.59
43 0.53
44 0.54
45 0.57
46 0.57
47 0.56
48 0.52
49 0.47
50 0.39
51 0.4
52 0.39
53 0.33
54 0.28
55 0.2
56 0.17
57 0.15
58 0.12
59 0.11
60 0.1
61 0.09
62 0.09
63 0.07
64 0.04
65 0.04
66 0.04
67 0.03
68 0.03
69 0.03
70 0.03
71 0.03
72 0.03
73 0.04
74 0.04
75 0.06
76 0.07
77 0.08
78 0.11
79 0.11
80 0.14
81 0.17
82 0.16
83 0.17
84 0.23
85 0.31
86 0.32
87 0.4
88 0.37
89 0.42
90 0.46
91 0.43
92 0.42
93 0.34
94 0.34
95 0.29
96 0.3
97 0.25
98 0.28
99 0.3
100 0.26
101 0.28
102 0.3