Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X2GE49

Protein Details
Accession A0A1X2GE49   
Localization Confidence Medium
Confidence Score 14
NoLS Segment(s)
PositionSequenceProtein Nature
14-34NINNRKKHNRGLTHIQNKKNHHydrophilic
96-125SMANLPKPSSQKKRKKQPHNKQAGRSKVYQHydrophilic
NLS Segment(s)
PositionSequence
102-119KPSSQKKRKKQPHNKQAG
Subcellular Location(s) nucl 14, cyto_nucl 11, cyto 6, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR013085  U1-CZ_Znf_C2H2  
IPR036236  Znf_C2H2_sf  
IPR000571  Znf_CCCH  
Gene Ontology GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00642  zf-CCCH  
PF06220  zf-U1  
PROSITE View protein in PROSITE  
PS50103  ZF_C3H1  
Amino Acid Sequences MYYCDFCQCSFPDNINNRKKHNRGLTHIQNKKNHYDWYRDPQLVIQEHLQKPPCRRFRQTRACDFGLNCIYSHVLFGPQGEPIYPPELTEWLHARSMANLPKPSSQKKRKKQPHNKQAGRSKVYQLPPGWQSSDLPPSLQPPPIDIGWDHAGGWG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.56
3 0.6
4 0.63
5 0.7
6 0.73
7 0.73
8 0.74
9 0.72
10 0.71
11 0.76
12 0.79
13 0.79
14 0.82
15 0.8
16 0.77
17 0.73
18 0.71
19 0.65
20 0.62
21 0.55
22 0.55
23 0.54
24 0.56
25 0.59
26 0.53
27 0.49
28 0.43
29 0.46
30 0.39
31 0.34
32 0.29
33 0.31
34 0.32
35 0.36
36 0.39
37 0.37
38 0.43
39 0.51
40 0.56
41 0.54
42 0.61
43 0.66
44 0.71
45 0.78
46 0.79
47 0.79
48 0.75
49 0.7
50 0.65
51 0.55
52 0.5
53 0.41
54 0.33
55 0.24
56 0.18
57 0.17
58 0.14
59 0.14
60 0.09
61 0.06
62 0.06
63 0.06
64 0.06
65 0.06
66 0.06
67 0.06
68 0.07
69 0.07
70 0.09
71 0.09
72 0.09
73 0.09
74 0.1
75 0.11
76 0.12
77 0.13
78 0.13
79 0.13
80 0.13
81 0.13
82 0.13
83 0.18
84 0.2
85 0.22
86 0.23
87 0.24
88 0.3
89 0.36
90 0.43
91 0.49
92 0.55
93 0.61
94 0.7
95 0.79
96 0.84
97 0.9
98 0.93
99 0.93
100 0.94
101 0.94
102 0.92
103 0.9
104 0.89
105 0.88
106 0.81
107 0.73
108 0.67
109 0.64
110 0.59
111 0.56
112 0.48
113 0.44
114 0.43
115 0.42
116 0.38
117 0.32
118 0.3
119 0.28
120 0.32
121 0.27
122 0.25
123 0.23
124 0.25
125 0.27
126 0.29
127 0.25
128 0.21
129 0.25
130 0.24
131 0.25
132 0.21
133 0.24
134 0.23
135 0.23