Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X2GSL9

Protein Details
Accession A0A1X2GSL9    Localization Confidence Low Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
42-64DTSYPSTPTKKKKNVRPGSPQEGHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13, nucl 12
Family & Domain DBs
InterPro View protein in InterPro  
IPR009449  Sec2_N  
Pfam View protein in Pfam  
PF06428  Sec2p  
Amino Acid Sequences MQPMNVFLQVPAPTASISSPTKQRHSGSASWAALVSPLPEDDTSYPSTPTKKKKNVRPGSPQEGGHCHRCCQLQREKETWLQQYHQQKEISLRAEHAMHKMQLELEELSASLFAAANQMVASERRARLAMEKEMEQL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.15
3 0.15
4 0.17
5 0.19
6 0.27
7 0.31
8 0.36
9 0.41
10 0.43
11 0.44
12 0.48
13 0.47
14 0.45
15 0.48
16 0.43
17 0.37
18 0.36
19 0.29
20 0.23
21 0.2
22 0.14
23 0.06
24 0.06
25 0.07
26 0.07
27 0.09
28 0.1
29 0.13
30 0.16
31 0.16
32 0.17
33 0.18
34 0.24
35 0.29
36 0.37
37 0.44
38 0.51
39 0.59
40 0.68
41 0.77
42 0.81
43 0.82
44 0.83
45 0.81
46 0.79
47 0.74
48 0.65
49 0.56
50 0.52
51 0.47
52 0.44
53 0.36
54 0.3
55 0.29
56 0.31
57 0.31
58 0.32
59 0.38
60 0.37
61 0.42
62 0.43
63 0.44
64 0.46
65 0.49
66 0.47
67 0.4
68 0.35
69 0.36
70 0.43
71 0.43
72 0.43
73 0.38
74 0.34
75 0.37
76 0.4
77 0.37
78 0.28
79 0.26
80 0.23
81 0.25
82 0.26
83 0.24
84 0.23
85 0.2
86 0.2
87 0.19
88 0.17
89 0.16
90 0.17
91 0.13
92 0.1
93 0.1
94 0.09
95 0.09
96 0.08
97 0.07
98 0.05
99 0.04
100 0.04
101 0.05
102 0.05
103 0.06
104 0.05
105 0.06
106 0.07
107 0.08
108 0.11
109 0.17
110 0.18
111 0.2
112 0.21
113 0.22
114 0.28
115 0.33
116 0.38
117 0.35