Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1X2GWY3

Protein Details
Accession A0A1X2GWY3    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-25MKVKGKGKRRKTMGQKRGSANKKKGBasic
NLS Segment(s)
PositionSequence
3-39VKGKGKRRKTMGQKRGSANKKKGGDKTRRTGSCKAKR
Subcellular Location(s) cyto 9.5cyto_nucl 9.5, mito 9, nucl 8.5
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MKVKGKGKRRKTMGQKRGSANKKKGGDKTRRTGSCKAKRTGQRLFIAMGATPIRFYKKRKAIDRWYGTAGICGVILYQFMISQRWLSSRRSFLVTLLCYQR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.85
3 0.83
4 0.85
5 0.84
6 0.83
7 0.8
8 0.78
9 0.76
10 0.75
11 0.76
12 0.76
13 0.76
14 0.75
15 0.76
16 0.77
17 0.76
18 0.75
19 0.74
20 0.75
21 0.75
22 0.74
23 0.68
24 0.67
25 0.68
26 0.7
27 0.68
28 0.64
29 0.56
30 0.49
31 0.47
32 0.39
33 0.32
34 0.24
35 0.19
36 0.12
37 0.09
38 0.08
39 0.08
40 0.11
41 0.14
42 0.18
43 0.26
44 0.34
45 0.43
46 0.51
47 0.59
48 0.65
49 0.73
50 0.75
51 0.68
52 0.62
53 0.56
54 0.48
55 0.39
56 0.3
57 0.19
58 0.13
59 0.1
60 0.07
61 0.05
62 0.05
63 0.04
64 0.04
65 0.05
66 0.06
67 0.07
68 0.08
69 0.09
70 0.11
71 0.16
72 0.18
73 0.23
74 0.29
75 0.34
76 0.36
77 0.39
78 0.39
79 0.36
80 0.42
81 0.39