Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1X2GSP7

Protein Details
Accession A0A1X2GSP7    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MQKHRGERGKKKSRWEACLFBasic
NLS Segment(s)
PositionSequence
5-12RGERGKKK
Subcellular Location(s) extr 10, mito 5, golg 5, E.R. 4, vacu 2
Family & Domain DBs
Amino Acid Sequences MQKHRGERGKKKSRWEACLFLFSFLFFINGLLSNEGGEEEEKRAKHAVASCFYTRVFFASRAPPFFSVILAGINF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.78
3 0.74
4 0.65
5 0.67
6 0.57
7 0.48
8 0.39
9 0.3
10 0.25
11 0.17
12 0.15
13 0.07
14 0.07
15 0.06
16 0.07
17 0.07
18 0.07
19 0.07
20 0.06
21 0.06
22 0.06
23 0.06
24 0.05
25 0.05
26 0.07
27 0.1
28 0.1
29 0.12
30 0.13
31 0.13
32 0.16
33 0.21
34 0.24
35 0.24
36 0.29
37 0.28
38 0.29
39 0.29
40 0.27
41 0.21
42 0.19
43 0.18
44 0.15
45 0.18
46 0.25
47 0.29
48 0.31
49 0.34
50 0.33
51 0.33
52 0.32
53 0.29
54 0.21
55 0.18