Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X2GC07

Protein Details
Accession A0A1X2GC07    Localization Confidence Medium Confidence Score 14.1
NoLS Segment(s)
PositionSequenceProtein Nature
159-180PPTPQETFKRADQRRRQGLRKKBasic
NLS Segment(s)
PositionSequence
171-180QRRRQGLRKK
Subcellular Location(s) nucl 23, cyto_nucl 14.5
Family & Domain DBs
Amino Acid Sequences MNAELKSYIKNAIEENLREFKLDLKRELQNTIDAHLEILKQEFVSKSELHTVIRTEPAAPAAPAKRTGDQEESVISRKRVKEAVNIAIATIEMGNAVKWDLNKPLNHPTNVAFKNQVWESVQNGAHAAVFKENKLAAFDCLNEIVKQKFHYQHRLVDNPPTPQETFKRADQRRRQGLRKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.35
3 0.36
4 0.34
5 0.33
6 0.32
7 0.33
8 0.36
9 0.39
10 0.37
11 0.36
12 0.42
13 0.44
14 0.47
15 0.41
16 0.38
17 0.35
18 0.32
19 0.28
20 0.22
21 0.2
22 0.18
23 0.17
24 0.11
25 0.12
26 0.11
27 0.09
28 0.11
29 0.11
30 0.11
31 0.14
32 0.14
33 0.15
34 0.2
35 0.21
36 0.2
37 0.21
38 0.21
39 0.2
40 0.22
41 0.2
42 0.15
43 0.14
44 0.15
45 0.14
46 0.12
47 0.15
48 0.14
49 0.15
50 0.18
51 0.2
52 0.21
53 0.22
54 0.26
55 0.26
56 0.24
57 0.24
58 0.22
59 0.22
60 0.23
61 0.23
62 0.2
63 0.22
64 0.22
65 0.24
66 0.26
67 0.26
68 0.29
69 0.31
70 0.34
71 0.31
72 0.3
73 0.27
74 0.23
75 0.22
76 0.15
77 0.09
78 0.05
79 0.03
80 0.03
81 0.03
82 0.03
83 0.03
84 0.04
85 0.05
86 0.06
87 0.11
88 0.15
89 0.16
90 0.2
91 0.29
92 0.33
93 0.33
94 0.33
95 0.31
96 0.36
97 0.37
98 0.35
99 0.28
100 0.24
101 0.28
102 0.27
103 0.26
104 0.19
105 0.19
106 0.19
107 0.23
108 0.23
109 0.18
110 0.19
111 0.17
112 0.15
113 0.14
114 0.13
115 0.13
116 0.13
117 0.13
118 0.15
119 0.15
120 0.15
121 0.17
122 0.17
123 0.14
124 0.14
125 0.15
126 0.14
127 0.16
128 0.17
129 0.15
130 0.17
131 0.17
132 0.18
133 0.2
134 0.26
135 0.32
136 0.38
137 0.47
138 0.49
139 0.55
140 0.61
141 0.64
142 0.59
143 0.61
144 0.58
145 0.53
146 0.52
147 0.48
148 0.41
149 0.41
150 0.43
151 0.4
152 0.41
153 0.43
154 0.51
155 0.55
156 0.65
157 0.7
158 0.76
159 0.81
160 0.86