Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X2GI33

Protein Details
Accession A0A1X2GI33    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
23-46GRQLRQQKLPKKQVRPHQQKISFFHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13, cyto_nucl 7.5, nucl 6.5, cyto 5.5
Family & Domain DBs
Amino Acid Sequences MKDQGLETLKIQAAAAPCLYGNGRQLRQQKLPKKQVRPHQQKISFFITLTTFVILQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.15
3 0.11
4 0.1
5 0.11
6 0.11
7 0.1
8 0.14
9 0.18
10 0.2
11 0.26
12 0.32
13 0.36
14 0.43
15 0.51
16 0.54
17 0.59
18 0.68
19 0.71
20 0.75
21 0.77
22 0.79
23 0.82
24 0.84
25 0.83
26 0.83
27 0.82
28 0.77
29 0.75
30 0.71
31 0.6
32 0.5
33 0.42
34 0.33
35 0.28
36 0.24