Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1X2GIV4

Protein Details
Accession A0A1X2GIV4    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
4-30QERRQRNKTASARYRAKKNQQHQDMRSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 24.5, cyto_nucl 14.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004827  bZIP  
IPR046347  bZIP_sf  
Gene Ontology GO:0003700  F:DNA-binding transcription factor activity  
Pfam View protein in Pfam  
PF07716  bZIP_2  
PROSITE View protein in PROSITE  
PS50217  BZIP  
PS00036  BZIP_BASIC  
Amino Acid Sequences LTLQERRQRNKTASARYRAKKNQQHQDMRSMINSLTKENDVLLRQLEQIMQENQQLKASCDKL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.74
2 0.77
3 0.75
4 0.81
5 0.79
6 0.81
7 0.79
8 0.8
9 0.8
10 0.81
11 0.84
12 0.76
13 0.75
14 0.67
15 0.58
16 0.49
17 0.4
18 0.3
19 0.25
20 0.23
21 0.15
22 0.14
23 0.13
24 0.13
25 0.12
26 0.15
27 0.12
28 0.12
29 0.13
30 0.12
31 0.12
32 0.13
33 0.13
34 0.12
35 0.15
36 0.16
37 0.17
38 0.21
39 0.23
40 0.23
41 0.28
42 0.27
43 0.25