Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X2G6Q1

Protein Details
Accession A0A1X2G6Q1   
Localization Confidence Medium
Confidence Score 14.8
NoLS Segment(s)
PositionSequenceProtein Nature
164-185TSEVKPKPKQDPPKAKPPKEHABasic
NLS Segment(s)
PositionSequence
144-155SPPRGKKSSHHK
166-203EVKPKPKQDPPKAKPPKEHAPKEDPPKADPPKEEPPKE
Subcellular Location(s) nucl 13, cyto 9, E.R. 2, mito 1, extr 1, vacu 1
Family & Domain DBs
Amino Acid Sequences MKVWQLMLLPVCMVHGHLLDAVRAGLITPVNQPDLSIDEQMKFADLDKECHPNSNAILKCQVDIQLCPPCWVKNGHRYDCYAHDVTGRCPWPDMLDISKLMRPATPPPPIIFDALGNHPARPQPPSYPMYPSPPSPPSPPSPPSPPRGKKSSHHKISTHSSGNTSEVKPKPKQDPPKAKPPKEHAPKEDPPKADPPKEEPPKEEPPKEEPPVEEPPVEDPAKETPAPAEEPKADVAEPTP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.09
3 0.09
4 0.11
5 0.12
6 0.11
7 0.12
8 0.11
9 0.09
10 0.08
11 0.08
12 0.07
13 0.07
14 0.09
15 0.11
16 0.14
17 0.16
18 0.16
19 0.16
20 0.15
21 0.18
22 0.19
23 0.19
24 0.18
25 0.17
26 0.18
27 0.18
28 0.17
29 0.14
30 0.13
31 0.17
32 0.16
33 0.19
34 0.22
35 0.29
36 0.28
37 0.32
38 0.32
39 0.27
40 0.29
41 0.34
42 0.32
43 0.28
44 0.32
45 0.28
46 0.28
47 0.26
48 0.28
49 0.2
50 0.2
51 0.23
52 0.25
53 0.25
54 0.27
55 0.28
56 0.24
57 0.25
58 0.3
59 0.31
60 0.33
61 0.43
62 0.46
63 0.46
64 0.48
65 0.49
66 0.47
67 0.47
68 0.38
69 0.29
70 0.28
71 0.27
72 0.26
73 0.3
74 0.27
75 0.21
76 0.21
77 0.2
78 0.18
79 0.18
80 0.19
81 0.14
82 0.14
83 0.15
84 0.16
85 0.17
86 0.16
87 0.15
88 0.13
89 0.13
90 0.17
91 0.21
92 0.24
93 0.24
94 0.24
95 0.27
96 0.28
97 0.27
98 0.22
99 0.17
100 0.14
101 0.15
102 0.18
103 0.15
104 0.14
105 0.14
106 0.15
107 0.15
108 0.15
109 0.16
110 0.14
111 0.19
112 0.21
113 0.22
114 0.26
115 0.27
116 0.31
117 0.3
118 0.29
119 0.28
120 0.29
121 0.3
122 0.28
123 0.29
124 0.28
125 0.32
126 0.33
127 0.32
128 0.38
129 0.4
130 0.43
131 0.5
132 0.53
133 0.53
134 0.55
135 0.56
136 0.55
137 0.62
138 0.67
139 0.66
140 0.65
141 0.62
142 0.62
143 0.65
144 0.65
145 0.58
146 0.48
147 0.41
148 0.36
149 0.37
150 0.35
151 0.28
152 0.3
153 0.3
154 0.36
155 0.38
156 0.43
157 0.49
158 0.54
159 0.64
160 0.66
161 0.73
162 0.72
163 0.79
164 0.84
165 0.81
166 0.8
167 0.77
168 0.77
169 0.76
170 0.79
171 0.75
172 0.74
173 0.76
174 0.77
175 0.76
176 0.67
177 0.61
178 0.63
179 0.62
180 0.59
181 0.54
182 0.52
183 0.56
184 0.63
185 0.62
186 0.57
187 0.57
188 0.63
189 0.68
190 0.66
191 0.59
192 0.57
193 0.63
194 0.62
195 0.58
196 0.5
197 0.47
198 0.49
199 0.47
200 0.4
201 0.33
202 0.31
203 0.35
204 0.32
205 0.26
206 0.21
207 0.23
208 0.27
209 0.26
210 0.23
211 0.2
212 0.23
213 0.28
214 0.28
215 0.29
216 0.25
217 0.27
218 0.29
219 0.28
220 0.25