Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X2G3T0

Protein Details
Accession A0A1X2G3T0    Localization Confidence Low Confidence Score 5.4
NoLS Segment(s)
PositionSequenceProtein Nature
77-102KWLPKACHFGKKRKTRCVRQRILIELHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 14, mito 6, E.R. 2, golg 2, nucl 1, pero 1, vacu 1
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MFGQVNMVDLKGGFSHRTDHLFVMKTMASNCLFCCHKLSFQTGSNPSFFSPFVFCKKPWVSTNPLSLGKPPTIGQKKWLPKACHFGKKRKTRCVRQRILIELLGITLPSCLFYILFFYLKRMPNIEK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.16
3 0.18
4 0.23
5 0.23
6 0.24
7 0.27
8 0.28
9 0.27
10 0.26
11 0.24
12 0.21
13 0.2
14 0.22
15 0.18
16 0.17
17 0.17
18 0.19
19 0.19
20 0.19
21 0.22
22 0.21
23 0.23
24 0.25
25 0.29
26 0.28
27 0.3
28 0.36
29 0.36
30 0.36
31 0.33
32 0.31
33 0.27
34 0.24
35 0.21
36 0.15
37 0.14
38 0.15
39 0.19
40 0.21
41 0.21
42 0.27
43 0.29
44 0.32
45 0.32
46 0.34
47 0.35
48 0.36
49 0.4
50 0.36
51 0.36
52 0.32
53 0.31
54 0.29
55 0.23
56 0.2
57 0.17
58 0.22
59 0.26
60 0.26
61 0.29
62 0.36
63 0.43
64 0.49
65 0.57
66 0.51
67 0.5
68 0.6
69 0.63
70 0.64
71 0.63
72 0.65
73 0.67
74 0.74
75 0.78
76 0.79
77 0.81
78 0.83
79 0.88
80 0.89
81 0.87
82 0.85
83 0.82
84 0.77
85 0.71
86 0.6
87 0.5
88 0.39
89 0.31
90 0.22
91 0.16
92 0.1
93 0.06
94 0.05
95 0.06
96 0.06
97 0.06
98 0.06
99 0.06
100 0.1
101 0.12
102 0.15
103 0.14
104 0.18
105 0.25
106 0.29
107 0.31