Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X2GJV2

Protein Details
Accession A0A1X2GJV2   
Localization Confidence Low
Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
83-116GLAEPGKGGRKQRKEKKNRAKKFRGTKKAAAAGGBasic
NLS Segment(s)
PositionSequence
72-118KFEPKHRLARIGLAEPGKGGRKQRKEKKNRAKKFRGTKKAAAAGGKK
Subcellular Location(s) mito 18, cyto 5.5, cyto_nucl 5, nucl 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR012678  Ribosomal_L23/L15e_core_dom_sf  
IPR001976  Ribosomal_S24e  
IPR018098  Ribosomal_S24e_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01282  Ribosomal_S24e  
PROSITE View protein in PROSITE  
PS00529  RIBOSOMAL_S24E  
Amino Acid Sequences MTNRLLGRKQMVVDIIHPGVANISREALREKLGKMYRADKEVVSVFGLKTHFGGGVTTGFALIYDNVEALKKFEPKHRLARIGLAEPGKGGRKQRKEKKNRAKKFRGTKKAAAAGGKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.23
3 0.2
4 0.19
5 0.16
6 0.15
7 0.15
8 0.15
9 0.1
10 0.12
11 0.12
12 0.13
13 0.16
14 0.16
15 0.18
16 0.19
17 0.19
18 0.26
19 0.29
20 0.32
21 0.33
22 0.39
23 0.39
24 0.39
25 0.39
26 0.3
27 0.3
28 0.27
29 0.24
30 0.18
31 0.15
32 0.12
33 0.13
34 0.14
35 0.11
36 0.1
37 0.1
38 0.09
39 0.08
40 0.08
41 0.06
42 0.06
43 0.06
44 0.05
45 0.05
46 0.04
47 0.04
48 0.04
49 0.04
50 0.04
51 0.04
52 0.04
53 0.04
54 0.05
55 0.05
56 0.06
57 0.09
58 0.13
59 0.15
60 0.22
61 0.29
62 0.34
63 0.44
64 0.48
65 0.5
66 0.47
67 0.52
68 0.48
69 0.43
70 0.42
71 0.33
72 0.27
73 0.22
74 0.24
75 0.22
76 0.21
77 0.28
78 0.33
79 0.43
80 0.54
81 0.64
82 0.73
83 0.8
84 0.89
85 0.92
86 0.93
87 0.94
88 0.94
89 0.94
90 0.94
91 0.94
92 0.94
93 0.93
94 0.9
95 0.87
96 0.85
97 0.82
98 0.76