Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X2GMT7

Protein Details
Accession A0A1X2GMT7   
Localization Confidence Medium
Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
49-72YNFELQAKRKKRKCLSLKKTGAKEHydrophilic
NLS Segment(s)
PositionSequence
56-61KRKKRK
Subcellular Location(s) mito 14.5, mito_nucl 14, nucl 12.5
Family & Domain DBs
Amino Acid Sequences RLVRRLIFQTIANKRSSSLNRKNISSSDWPEAKDIIAIHGDSSDEGDIYNFELQAKRKKRKCLSLKKTGAKEPDEKEAFSFTDPGENDWKVAILKDAPKLLAKEKAGVLKTPDITSYQQSVRGECGLVQDEERSSKGLPFFRTNSKVLQSSGGPACLPSSQKESLPPLKRSCIPS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.45
3 0.5
4 0.5
5 0.52
6 0.58
7 0.6
8 0.63
9 0.65
10 0.58
11 0.55
12 0.52
13 0.47
14 0.45
15 0.43
16 0.42
17 0.4
18 0.38
19 0.32
20 0.26
21 0.21
22 0.15
23 0.14
24 0.13
25 0.11
26 0.11
27 0.11
28 0.08
29 0.1
30 0.08
31 0.06
32 0.06
33 0.06
34 0.06
35 0.07
36 0.08
37 0.07
38 0.08
39 0.11
40 0.15
41 0.25
42 0.34
43 0.42
44 0.48
45 0.58
46 0.65
47 0.73
48 0.8
49 0.82
50 0.81
51 0.82
52 0.86
53 0.83
54 0.8
55 0.74
56 0.69
57 0.61
58 0.59
59 0.5
60 0.49
61 0.43
62 0.38
63 0.33
64 0.3
65 0.26
66 0.2
67 0.19
68 0.1
69 0.13
70 0.13
71 0.14
72 0.16
73 0.15
74 0.15
75 0.14
76 0.14
77 0.1
78 0.1
79 0.09
80 0.07
81 0.1
82 0.12
83 0.12
84 0.13
85 0.14
86 0.16
87 0.17
88 0.21
89 0.19
90 0.19
91 0.21
92 0.25
93 0.24
94 0.24
95 0.24
96 0.22
97 0.23
98 0.21
99 0.2
100 0.18
101 0.19
102 0.2
103 0.21
104 0.18
105 0.22
106 0.22
107 0.22
108 0.21
109 0.2
110 0.18
111 0.15
112 0.17
113 0.14
114 0.14
115 0.13
116 0.13
117 0.13
118 0.15
119 0.15
120 0.14
121 0.12
122 0.15
123 0.19
124 0.23
125 0.26
126 0.3
127 0.34
128 0.41
129 0.45
130 0.44
131 0.43
132 0.43
133 0.41
134 0.37
135 0.36
136 0.28
137 0.3
138 0.29
139 0.26
140 0.21
141 0.19
142 0.19
143 0.19
144 0.2
145 0.18
146 0.22
147 0.23
148 0.25
149 0.3
150 0.36
151 0.43
152 0.5
153 0.54
154 0.54
155 0.58