Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X2GVE0

Protein Details
Accession A0A1X2GVE0   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
66-90GDLFVKHNKARKKKHKYGWSPSFLFHydrophilic
NLS Segment(s)
PositionSequence
73-81NKARKKKHK
Subcellular Location(s) plas 12, mito 6, E.R. 4, extr 3, cyto_mito 3, mito_nucl 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MLHDFFSCSMTFFCSMIFIQTCSMIFSCFMIYIHAPWLFLKLHESERERNPLPFGGGMCSSFWWHGDLFVKHNKARKKKHKYGWSPSFLFELQHGACATCLTF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.13
3 0.16
4 0.16
5 0.14
6 0.13
7 0.14
8 0.14
9 0.14
10 0.14
11 0.11
12 0.1
13 0.1
14 0.09
15 0.09
16 0.09
17 0.09
18 0.09
19 0.09
20 0.12
21 0.12
22 0.12
23 0.11
24 0.13
25 0.12
26 0.12
27 0.13
28 0.12
29 0.15
30 0.19
31 0.23
32 0.25
33 0.29
34 0.35
35 0.34
36 0.32
37 0.3
38 0.26
39 0.23
40 0.19
41 0.15
42 0.11
43 0.11
44 0.11
45 0.09
46 0.1
47 0.09
48 0.09
49 0.09
50 0.08
51 0.08
52 0.1
53 0.14
54 0.15
55 0.18
56 0.25
57 0.29
58 0.31
59 0.37
60 0.44
61 0.49
62 0.59
63 0.66
64 0.7
65 0.76
66 0.84
67 0.89
68 0.9
69 0.91
70 0.9
71 0.87
72 0.78
73 0.7
74 0.63
75 0.53
76 0.43
77 0.33
78 0.29
79 0.21
80 0.22
81 0.2
82 0.17
83 0.17