Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X2GMM8

Protein Details
Accession A0A1X2GMM8    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
97-129LAEAGKGGRKQRKEKKNRAKKFRGTKKAAAAGGBasic
NLS Segment(s)
PositionSequence
86-131FEPKHRLARIGLAEAGKGGRKQRKEKKNRAKKFRGTKKAAAAGGKK
Subcellular Location(s) mito 19, cyto 5.5, cyto_nucl 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR012678  Ribosomal_L23/L15e_core_dom_sf  
IPR001976  Ribosomal_S24e  
IPR018098  Ribosomal_S24e_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01282  Ribosomal_S24e  
PROSITE View protein in PROSITE  
PS00529  RIBOSOMAL_S24E  
Amino Acid Sequences MADATVTLRTRKFMTNRLLGRKQMVVDIIHPGVANISREALREKLGKMYRADKEVVSVFGLKTHFGGGVTTGFALIYDNVEALKKFEPKHRLARIGLAEAGKGGRKQRKEKKNRAKKFRGTKKAAAAGGKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.5
3 0.57
4 0.64
5 0.67
6 0.62
7 0.6
8 0.55
9 0.47
10 0.4
11 0.35
12 0.26
13 0.22
14 0.24
15 0.2
16 0.18
17 0.16
18 0.14
19 0.13
20 0.13
21 0.13
22 0.09
23 0.1
24 0.1
25 0.11
26 0.14
27 0.14
28 0.15
29 0.17
30 0.17
31 0.24
32 0.26
33 0.29
34 0.3
35 0.36
36 0.35
37 0.35
38 0.36
39 0.27
40 0.27
41 0.24
42 0.22
43 0.16
44 0.14
45 0.11
46 0.12
47 0.12
48 0.1
49 0.09
50 0.09
51 0.08
52 0.07
53 0.07
54 0.05
55 0.06
56 0.05
57 0.05
58 0.05
59 0.04
60 0.04
61 0.04
62 0.04
63 0.04
64 0.04
65 0.04
66 0.04
67 0.05
68 0.05
69 0.07
70 0.1
71 0.14
72 0.16
73 0.23
74 0.3
75 0.35
76 0.45
77 0.49
78 0.52
79 0.49
80 0.53
81 0.48
82 0.44
83 0.41
84 0.31
85 0.25
86 0.2
87 0.2
88 0.15
89 0.16
90 0.21
91 0.26
92 0.34
93 0.45
94 0.55
95 0.65
96 0.74
97 0.83
98 0.87
99 0.91
100 0.94
101 0.94
102 0.94
103 0.94
104 0.94
105 0.94
106 0.93
107 0.9
108 0.87
109 0.85
110 0.82
111 0.76