Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X2GMD2

Protein Details
Accession A0A1X2GMD2    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
9-37KPTSSSGGKKAKKKWSAKKVKDKANNMVVHydrophilic
NLS Segment(s)
PositionSequence
10-31PTSSSGGKKAKKKWSAKKVKDK
Subcellular Location(s) nucl 20.5, mito_nucl 11, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MAKKDAAAKPTSSSGGKKAKKKWSAKKVKDKANNMVVLDKPTYERLFKEVPTYKLISQSILVDRLKLNASLARVAIKELENQGLIKALSRHHAQVIYTRASGDDN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.42
3 0.47
4 0.52
5 0.58
6 0.65
7 0.72
8 0.79
9 0.82
10 0.83
11 0.87
12 0.89
13 0.91
14 0.9
15 0.9
16 0.89
17 0.85
18 0.82
19 0.77
20 0.7
21 0.59
22 0.54
23 0.44
24 0.37
25 0.31
26 0.23
27 0.17
28 0.17
29 0.18
30 0.16
31 0.16
32 0.17
33 0.19
34 0.19
35 0.25
36 0.27
37 0.27
38 0.29
39 0.31
40 0.27
41 0.3
42 0.29
43 0.22
44 0.18
45 0.18
46 0.16
47 0.18
48 0.18
49 0.14
50 0.14
51 0.15
52 0.15
53 0.14
54 0.13
55 0.11
56 0.12
57 0.12
58 0.13
59 0.13
60 0.12
61 0.12
62 0.14
63 0.12
64 0.14
65 0.15
66 0.16
67 0.15
68 0.15
69 0.15
70 0.14
71 0.14
72 0.13
73 0.14
74 0.13
75 0.17
76 0.2
77 0.22
78 0.23
79 0.25
80 0.24
81 0.29
82 0.33
83 0.32
84 0.3
85 0.28