Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X2GVF1

Protein Details
Accession A0A1X2GVF1   
Localization Confidence Low
Confidence Score 7.5
NoLS Segment(s)
PositionSequenceProtein Nature
178-198AIDWLIKRLQRNKINRPPLYQHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 12.333, nucl 11, cyto 9.5, cyto_mito 6.332, pero 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR027417  P-loop_NTPase  
IPR005225  Small_GTP-bd_dom  
IPR024156  Small_GTPase_ARF  
IPR006689  Small_GTPase_ARF/SAR  
Gene Ontology GO:0005525  F:GTP binding  
GO:0003924  F:GTPase activity  
Pfam View protein in Pfam  
PF00025  Arf  
PROSITE View protein in PROSITE  
PS51417  ARF  
PS51419  RAB  
CDD cd04160  Arfrp1  
Amino Acid Sequences MYTLLSGLYQYVTQKEEYNILIIGLDNAGKTTLLEKIKSTYMDTPGLPADRIAPTVGLNIGRIEIQSSKLKFWDLGGQHDLQTIWERYYSECHAILFVVDSTDKRRLEECKDTFETMVTNDLVEGVPILMLANKQDINDALRVEDIKEVFNKIAVKLGARDSRVLPISALEGNGVHEAIDWLIKRLQRNKINRPPLYQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.19
3 0.22
4 0.21
5 0.21
6 0.18
7 0.16
8 0.15
9 0.12
10 0.11
11 0.08
12 0.08
13 0.06
14 0.06
15 0.07
16 0.06
17 0.07
18 0.07
19 0.13
20 0.16
21 0.17
22 0.18
23 0.21
24 0.24
25 0.25
26 0.27
27 0.25
28 0.26
29 0.28
30 0.26
31 0.25
32 0.25
33 0.24
34 0.21
35 0.17
36 0.15
37 0.13
38 0.14
39 0.13
40 0.11
41 0.1
42 0.11
43 0.12
44 0.09
45 0.09
46 0.08
47 0.08
48 0.08
49 0.08
50 0.08
51 0.08
52 0.11
53 0.17
54 0.18
55 0.18
56 0.19
57 0.2
58 0.18
59 0.18
60 0.22
61 0.17
62 0.2
63 0.22
64 0.22
65 0.21
66 0.22
67 0.21
68 0.14
69 0.17
70 0.13
71 0.11
72 0.11
73 0.11
74 0.11
75 0.15
76 0.16
77 0.15
78 0.14
79 0.14
80 0.13
81 0.12
82 0.12
83 0.08
84 0.07
85 0.05
86 0.05
87 0.05
88 0.08
89 0.14
90 0.14
91 0.15
92 0.17
93 0.2
94 0.26
95 0.35
96 0.34
97 0.35
98 0.37
99 0.37
100 0.35
101 0.32
102 0.26
103 0.17
104 0.18
105 0.1
106 0.08
107 0.07
108 0.07
109 0.07
110 0.06
111 0.06
112 0.03
113 0.03
114 0.03
115 0.03
116 0.03
117 0.04
118 0.04
119 0.06
120 0.07
121 0.07
122 0.08
123 0.09
124 0.11
125 0.13
126 0.13
127 0.11
128 0.11
129 0.12
130 0.12
131 0.14
132 0.12
133 0.12
134 0.13
135 0.14
136 0.14
137 0.16
138 0.17
139 0.14
140 0.19
141 0.17
142 0.18
143 0.18
144 0.25
145 0.27
146 0.27
147 0.29
148 0.25
149 0.3
150 0.3
151 0.28
152 0.22
153 0.18
154 0.19
155 0.17
156 0.16
157 0.11
158 0.1
159 0.11
160 0.12
161 0.11
162 0.08
163 0.07
164 0.08
165 0.08
166 0.11
167 0.1
168 0.12
169 0.16
170 0.19
171 0.26
172 0.34
173 0.44
174 0.5
175 0.59
176 0.68
177 0.75
178 0.83