Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X2GIE4

Protein Details
Accession A0A1X2GIE4    Localization Confidence High Confidence Score 15.6
NoLS Segment(s)
PositionSequenceProtein Nature
10-35AATNPNKKSARPKQTKVKKGSRTIAPHydrophilic
NLS Segment(s)
PositionSequence
7-32KKKAATNPNKKSARPKQTKVKKGSRT
90-92KKK
Subcellular Location(s) nucl 20.5, cyto_nucl 12.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR019034  UPF0390  
Pfam View protein in Pfam  
PF09495  DUF2462  
Amino Acid Sequences MAQGALKKKAATNPNKKSARPKQTKVKKGSRTIAPKQTTLVKQRSLQKKLTATINRNIEKQMSVKANAVGKLTIMKKLAEDTASEQTPKKKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.69
2 0.73
3 0.74
4 0.77
5 0.77
6 0.78
7 0.76
8 0.76
9 0.77
10 0.82
11 0.88
12 0.86
13 0.86
14 0.84
15 0.82
16 0.81
17 0.78
18 0.77
19 0.75
20 0.75
21 0.67
22 0.59
23 0.52
24 0.52
25 0.48
26 0.46
27 0.43
28 0.37
29 0.39
30 0.47
31 0.54
32 0.52
33 0.5
34 0.48
35 0.46
36 0.45
37 0.49
38 0.47
39 0.42
40 0.44
41 0.49
42 0.46
43 0.44
44 0.42
45 0.35
46 0.3
47 0.27
48 0.26
49 0.21
50 0.21
51 0.22
52 0.25
53 0.27
54 0.26
55 0.26
56 0.2
57 0.17
58 0.22
59 0.21
60 0.22
61 0.2
62 0.19
63 0.19
64 0.21
65 0.23
66 0.18
67 0.19
68 0.2
69 0.25
70 0.27
71 0.28
72 0.29