Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X2GAM8

Protein Details
Accession A0A1X2GAM8    Localization Confidence Low Confidence Score 5.8
NoLS Segment(s)
PositionSequenceProtein Nature
42-66LVSVWLHWKNYRKPNQQRQVIRILWHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 7, plas 6, E.R. 5, extr 4, nucl 2, golg 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR005178  Ostalpha/TMEM184C  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF03619  Solute_trans_a  
Amino Acid Sequences MSSPHVTEKGYGYGEGGAGSEFNPLAIHLALVFTLVGTCISLVSVWLHWKNYRKPNQQRQVIRILWM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.14
3 0.11
4 0.07
5 0.06
6 0.06
7 0.06
8 0.05
9 0.05
10 0.05
11 0.05
12 0.06
13 0.06
14 0.05
15 0.04
16 0.05
17 0.04
18 0.04
19 0.04
20 0.03
21 0.03
22 0.03
23 0.03
24 0.03
25 0.03
26 0.02
27 0.03
28 0.03
29 0.04
30 0.04
31 0.06
32 0.1
33 0.12
34 0.15
35 0.2
36 0.28
37 0.37
38 0.46
39 0.56
40 0.62
41 0.72
42 0.8
43 0.86
44 0.88
45 0.88
46 0.83
47 0.82