Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X2GD08

Protein Details
Accession A0A1X2GD08    Localization Confidence Low Confidence Score 6.8
NoLS Segment(s)
PositionSequenceProtein Nature
257-276AAFMAAKKKRQEQQHQTLVTHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 17, nucl 5.5, cyto_nucl 5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004511  PAPS/APS_Rdtase  
IPR002500  PAPS_reduct  
IPR011800  PAPS_reductase_CysH  
IPR014729  Rossmann-like_a/b/a_fold  
Gene Ontology GO:0004604  F:phosphoadenylyl-sulfate reductase (thioredoxin) activity  
GO:0019379  P:sulfate assimilation, phosphoadenylyl sulfate reduction by phosphoadenylyl-sulfate reductase (thioredoxin)  
Pfam View protein in Pfam  
PF01507  PAPS_reduct  
CDD cd01713  PAPS_reductase  
Amino Acid Sequences MPVSTSSIKITSSKQLTQAYLASINEYLWTLTPQEILTWAIDHLPNLYQTTAFGLTGLATADMISKISLDRNQPHLVPLIFLDTLYHFQETLDLAHRVKATYDAPLHVFHPVGTPTTEAFENEHGEELWKADEDSYDYLVKVEPSRRAYEQLDVASVITGRRRSQRGDRENIPILEVDGTGLIKLNPLALWDFQQVWTYIRANEVPYNALVDQGYKSIGDRHSTKRPSEAQGERDGRWSGSQKTECGLHKDYFKMRAAFMAAKKKRQEQQHQTLVTA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.43
3 0.43
4 0.43
5 0.41
6 0.34
7 0.32
8 0.29
9 0.24
10 0.19
11 0.18
12 0.16
13 0.15
14 0.12
15 0.1
16 0.11
17 0.1
18 0.1
19 0.12
20 0.11
21 0.11
22 0.12
23 0.12
24 0.12
25 0.11
26 0.11
27 0.12
28 0.12
29 0.12
30 0.12
31 0.12
32 0.13
33 0.14
34 0.14
35 0.11
36 0.11
37 0.14
38 0.14
39 0.12
40 0.11
41 0.09
42 0.09
43 0.09
44 0.09
45 0.06
46 0.04
47 0.05
48 0.06
49 0.06
50 0.06
51 0.05
52 0.05
53 0.06
54 0.09
55 0.13
56 0.18
57 0.22
58 0.28
59 0.3
60 0.3
61 0.31
62 0.32
63 0.28
64 0.23
65 0.19
66 0.16
67 0.14
68 0.13
69 0.12
70 0.1
71 0.12
72 0.13
73 0.13
74 0.1
75 0.09
76 0.11
77 0.11
78 0.11
79 0.12
80 0.13
81 0.13
82 0.16
83 0.16
84 0.15
85 0.15
86 0.16
87 0.13
88 0.16
89 0.17
90 0.16
91 0.17
92 0.18
93 0.18
94 0.16
95 0.15
96 0.11
97 0.11
98 0.11
99 0.1
100 0.09
101 0.1
102 0.09
103 0.11
104 0.11
105 0.09
106 0.1
107 0.11
108 0.12
109 0.11
110 0.11
111 0.09
112 0.1
113 0.09
114 0.09
115 0.07
116 0.06
117 0.06
118 0.05
119 0.06
120 0.07
121 0.07
122 0.09
123 0.09
124 0.09
125 0.09
126 0.09
127 0.1
128 0.1
129 0.12
130 0.16
131 0.18
132 0.21
133 0.22
134 0.26
135 0.26
136 0.26
137 0.26
138 0.21
139 0.19
140 0.16
141 0.15
142 0.11
143 0.1
144 0.08
145 0.08
146 0.1
147 0.11
148 0.17
149 0.19
150 0.24
151 0.33
152 0.43
153 0.48
154 0.53
155 0.55
156 0.55
157 0.57
158 0.53
159 0.45
160 0.34
161 0.26
162 0.2
163 0.16
164 0.1
165 0.06
166 0.06
167 0.05
168 0.05
169 0.05
170 0.05
171 0.05
172 0.05
173 0.05
174 0.06
175 0.07
176 0.07
177 0.1
178 0.11
179 0.12
180 0.12
181 0.14
182 0.13
183 0.13
184 0.16
185 0.15
186 0.14
187 0.15
188 0.16
189 0.17
190 0.19
191 0.19
192 0.17
193 0.16
194 0.18
195 0.16
196 0.16
197 0.13
198 0.12
199 0.11
200 0.11
201 0.11
202 0.08
203 0.09
204 0.13
205 0.15
206 0.19
207 0.24
208 0.3
209 0.39
210 0.44
211 0.45
212 0.48
213 0.51
214 0.52
215 0.56
216 0.56
217 0.5
218 0.56
219 0.58
220 0.51
221 0.5
222 0.46
223 0.38
224 0.36
225 0.36
226 0.31
227 0.36
228 0.38
229 0.35
230 0.36
231 0.41
232 0.4
233 0.42
234 0.42
235 0.36
236 0.38
237 0.44
238 0.46
239 0.47
240 0.49
241 0.44
242 0.4
243 0.39
244 0.39
245 0.4
246 0.42
247 0.46
248 0.46
249 0.52
250 0.58
251 0.64
252 0.66
253 0.7
254 0.74
255 0.74
256 0.79
257 0.8