Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1X2GJZ3

Protein Details
Accession A0A1X2GJZ3    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
36-71AKTGEITIEKRRRRRKKKEKKSERERERERERERERBasic
NLS Segment(s)
PositionSequence
45-93KRRRRRKKKEKKSERERERERERERERERERERERERERERERERERER
Subcellular Location(s) mito 19, nucl 8
Family & Domain DBs
Amino Acid Sequences MSPIHRPAKAGTIKRPLFIEKGSGLVFNLFLWQRLAKTGEITIEKRRRRRKKKEKKSERERERERERERERERERERERERERERERERERERESIHG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.55
3 0.49
4 0.44
5 0.38
6 0.34
7 0.24
8 0.25
9 0.23
10 0.21
11 0.18
12 0.15
13 0.14
14 0.09
15 0.12
16 0.09
17 0.1
18 0.11
19 0.11
20 0.11
21 0.13
22 0.15
23 0.12
24 0.13
25 0.13
26 0.15
27 0.17
28 0.19
29 0.27
30 0.33
31 0.39
32 0.46
33 0.57
34 0.65
35 0.72
36 0.82
37 0.84
38 0.87
39 0.93
40 0.95
41 0.96
42 0.96
43 0.97
44 0.96
45 0.95
46 0.94
47 0.91
48 0.9
49 0.87
50 0.86
51 0.81
52 0.8
53 0.76
54 0.76
55 0.73
56 0.74
57 0.71
58 0.71
59 0.71
60 0.71
61 0.71
62 0.71
63 0.71
64 0.71
65 0.71
66 0.71
67 0.71
68 0.71
69 0.71
70 0.71
71 0.71
72 0.71
73 0.71
74 0.71
75 0.71
76 0.71
77 0.71
78 0.69