Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X2GWJ5

Protein Details
Accession A0A1X2GWJ5    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MPHPFKFKPKRRPFVELQEDRBasic
NLS Segment(s)
Subcellular Location(s) plas 20, E.R. 4, mito 1, pero 1, vacu 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR044234  TMEM230  
IPR008590  TMEM_230/134  
Gene Ontology GO:0005776  C:autophagosome  
GO:0005769  C:early endosome  
GO:0005794  C:Golgi apparatus  
GO:0005770  C:late endosome  
GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF05915  TMEM_230_134  
Amino Acid Sequences MPHPFKFKPKRRPFVELQEDRGFSADQFVQPEAKIPWKAIGLASLLFLVGSMLIVLGVMIKLGYITSDVWLDRGIPFLVIGSIMFIPGSYHMYIAYYAYYKYPGYDFSMIPEWDD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.83
3 0.77
4 0.73
5 0.69
6 0.62
7 0.54
8 0.48
9 0.37
10 0.26
11 0.25
12 0.19
13 0.14
14 0.15
15 0.16
16 0.15
17 0.15
18 0.18
19 0.15
20 0.19
21 0.19
22 0.17
23 0.19
24 0.18
25 0.19
26 0.16
27 0.16
28 0.12
29 0.11
30 0.1
31 0.08
32 0.07
33 0.06
34 0.06
35 0.04
36 0.03
37 0.02
38 0.02
39 0.02
40 0.02
41 0.02
42 0.02
43 0.02
44 0.02
45 0.02
46 0.02
47 0.02
48 0.02
49 0.02
50 0.02
51 0.03
52 0.04
53 0.04
54 0.06
55 0.06
56 0.06
57 0.07
58 0.07
59 0.06
60 0.08
61 0.07
62 0.06
63 0.06
64 0.06
65 0.06
66 0.05
67 0.05
68 0.05
69 0.05
70 0.05
71 0.05
72 0.04
73 0.05
74 0.06
75 0.09
76 0.08
77 0.08
78 0.08
79 0.09
80 0.1
81 0.1
82 0.1
83 0.08
84 0.09
85 0.1
86 0.12
87 0.12
88 0.13
89 0.14
90 0.14
91 0.2
92 0.22
93 0.21
94 0.24
95 0.3