FuNGI

A0A1X2GW22

Protein Details

Accession

A0A1X2GW22

Localization Confidence

Medium

Confidence Score

NoLS Segment(s)

Position	Sequence	Protein Nature
74-93	LIPWRTKYIQQAKENRHNTF	Hydrophilic

NLS Segment(s)

Subcellular Location(s)

nucl 18, mito 4, cyto 4, cyto_mito 4

Family & Domain DBs

InterPro	View protein in InterPro IPR005549 Kinetochore_Nuf2_N IPR038275 Nuf2_N_sf
Gene Ontology	GO:0031262 C:Ndc80 complex GO:0007049 P:cell cycle GO:0051301 P:cell division
Pfam	View protein in Pfam PF03800 Nuf2

Amino Acid Sequences

MLRSRFPLNATSYSNHGGVEVDEQQRTQYDIPTLTISQIIKCLSDMNIHITNHDLIQPSSNRIVLVYESLLHLLIPWRTKYIQQAKENRHNTFGHHELRQDTTYMISIYFQMQYLLLSIRYRDFVLTDVAAPTSTRLQHILSAIINYVKFRDDMWKVFHPLSSHAEDVVLESQKLADEVDELTQKLADQKLRLQQQEPDTRKLEEWIEKERDNAASLESLAKQYHFESNEKKMARKVAKTKLKEIQERAMALVEEIRKLKTRKDYDHQEAQTRLHELKEQIEQRQEAFDKEQTKTQRADKKGDKLGHITRQLQSCVSYGQNIVHVWTSQEQMRLDIADLDRKINECATKLKEIDTKCNMLRRQVALYEAKTQKIYDHLSKKRETLELHMTKKKLELQEANETAAATRLELNQSKEAVRQLQLKIENVQQDLELDVSRFNDLCKRLLMAADHALDIPKITP

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.38
2	0.32
3	0.26
4	0.21
5	0.18
6	0.2
7	0.22
8	0.22
9	0.23
10	0.23
11	0.24
12	0.24
13	0.27
14	0.24
15	0.2
16	0.21
17	0.22
18	0.24
19	0.26
20	0.26
21	0.23
22	0.26
23	0.23
24	0.2
25	0.22
26	0.21
27	0.18
28	0.17
29	0.18
30	0.15
31	0.19
32	0.19
33	0.22
34	0.27
35	0.27
36	0.27
37	0.28
38	0.27
39	0.24
40	0.26
41	0.21
42	0.16
43	0.22
44	0.24
45	0.25
46	0.27
47	0.27
48	0.23
49	0.22
50	0.23
51	0.17
52	0.17
53	0.14
54	0.12
55	0.12
56	0.12
57	0.12
58	0.1
59	0.1
60	0.11
61	0.14
62	0.17
63	0.17
64	0.2
65	0.22
66	0.25
67	0.35
68	0.42
69	0.48
70	0.53
71	0.62
72	0.68
73	0.77
74	0.81
75	0.73
76	0.68
77	0.6
78	0.54
79	0.52
80	0.49
81	0.44
82	0.39
83	0.4
84	0.37
85	0.4
86	0.37
87	0.3
88	0.23
89	0.19
90	0.18
91	0.16
92	0.13
93	0.1
94	0.1
95	0.11
96	0.11
97	0.1
98	0.09
99	0.09
100	0.09
101	0.09
102	0.1
103	0.09
104	0.09
105	0.1
106	0.11
107	0.12
108	0.13
109	0.12
110	0.11
111	0.11
112	0.13
113	0.12
114	0.12
115	0.11
116	0.11
117	0.1
118	0.1
119	0.1
120	0.11
121	0.11
122	0.12
123	0.13
124	0.13
125	0.15
126	0.16
127	0.17
128	0.14
129	0.14
130	0.14
131	0.14
132	0.14
133	0.11
134	0.11
135	0.1
136	0.1
137	0.1
138	0.16
139	0.18
140	0.21
141	0.27
142	0.3
143	0.32
144	0.33
145	0.34
146	0.28
147	0.28
148	0.29
149	0.26
150	0.22
151	0.19
152	0.19
153	0.17
154	0.17
155	0.17
156	0.13
157	0.1
158	0.09
159	0.09
160	0.09
161	0.09
162	0.08
163	0.04
164	0.04
165	0.05
166	0.07
167	0.08
168	0.08
169	0.08
170	0.08
171	0.08
172	0.11
173	0.13
174	0.13
175	0.13
176	0.18
177	0.25
178	0.31
179	0.32
180	0.31
181	0.33
182	0.39
183	0.48
184	0.47
185	0.45
186	0.41
187	0.41
188	0.39
189	0.36
190	0.32
191	0.28
192	0.27
193	0.29
194	0.31
195	0.3
196	0.31
197	0.3
198	0.27
199	0.23
200	0.2
201	0.13
202	0.1
203	0.1
204	0.1
205	0.09
206	0.1
207	0.09
208	0.09
209	0.09
210	0.1
211	0.14
212	0.14
213	0.17
214	0.2
215	0.25
216	0.31
217	0.31
218	0.31
219	0.3
220	0.36
221	0.38
222	0.4
223	0.43
224	0.47
225	0.55
226	0.56
227	0.6
228	0.59
229	0.61
230	0.6
231	0.55
232	0.5
233	0.44
234	0.42
235	0.36
236	0.3
237	0.23
238	0.17
239	0.16
240	0.12
241	0.11
242	0.11
243	0.12
244	0.16
245	0.17
246	0.22
247	0.29
248	0.35
249	0.4
250	0.47
251	0.55
252	0.57
253	0.65
254	0.63
255	0.58
256	0.54
257	0.48
258	0.42
259	0.36
260	0.29
261	0.21
262	0.22
263	0.18
264	0.18
265	0.24
266	0.25
267	0.26
268	0.29
269	0.29
270	0.26
271	0.3
272	0.27
273	0.22
274	0.22
275	0.23
276	0.24
277	0.24
278	0.29
279	0.29
280	0.32
281	0.34
282	0.4
283	0.44
284	0.44
285	0.52
286	0.53
287	0.57
288	0.61
289	0.61
290	0.55
291	0.54
292	0.56
293	0.54
294	0.53
295	0.48
296	0.44
297	0.44
298	0.43
299	0.36
300	0.32
301	0.25
302	0.22
303	0.19
304	0.16
305	0.14
306	0.13
307	0.15
308	0.14
309	0.14
310	0.13
311	0.12
312	0.12
313	0.13
314	0.15
315	0.14
316	0.18
317	0.17
318	0.17
319	0.18
320	0.17
321	0.15
322	0.17
323	0.16
324	0.18
325	0.19
326	0.19
327	0.19
328	0.2
329	0.2
330	0.19
331	0.2
332	0.16
333	0.22
334	0.26
335	0.3
336	0.29
337	0.33
338	0.36
339	0.36
340	0.43
341	0.42
342	0.43
343	0.41
344	0.48
345	0.45
346	0.46
347	0.49
348	0.43
349	0.42
350	0.38
351	0.4
352	0.37
353	0.37
354	0.41
355	0.38
356	0.37
357	0.34
358	0.33
359	0.29
360	0.3
361	0.34
362	0.34
363	0.41
364	0.47
365	0.53
366	0.56
367	0.58
368	0.56
369	0.56
370	0.49
371	0.46
372	0.49
373	0.51
374	0.55
375	0.58
376	0.55
377	0.5
378	0.52
379	0.52
380	0.46
381	0.46
382	0.45
383	0.45
384	0.54
385	0.55
386	0.52
387	0.46
388	0.41
389	0.32
390	0.28
391	0.22
392	0.12
393	0.13
394	0.13
395	0.19
396	0.23
397	0.27
398	0.29
399	0.31
400	0.31
401	0.32
402	0.35
403	0.33
404	0.34
405	0.37
406	0.35
407	0.4
408	0.43
409	0.43
410	0.41
411	0.42
412	0.42
413	0.36
414	0.35
415	0.28
416	0.24
417	0.22
418	0.2
419	0.16
420	0.11
421	0.12
422	0.12
423	0.14
424	0.14
425	0.15
426	0.2
427	0.22
428	0.24
429	0.24
430	0.26
431	0.25
432	0.29
433	0.29
434	0.27
435	0.3
436	0.29
437	0.28
438	0.26
439	0.25
440	0.21

A0A1X2GW22

3D AlphaFold-predicted Structure Viewer