Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X2GH38

Protein Details
Accession A0A1X2GH38   
Localization Confidence High
Confidence Score 16.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MGRSAKFYKRPSKKQKEVTKLTKSEIHydrophilic
NLS Segment(s)
PositionSequence
9-16KRPSKKQK
99-106YKRVPKRR
Subcellular Location(s) nucl 19, mito 4, cyto 4, cyto_mito 4
Family & Domain DBs
Amino Acid Sequences MGRSAKFYKRPSKKQKEVTKLTKSEIKKPESGSMTKPSVATQAAKAVAMAIDKQPVSVKKPQANAMEIDTPKPKTKPADNALLPEKPDYVDLFTGKKTYKRVPKRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.9
2 0.92
3 0.92
4 0.91
5 0.9
6 0.88
7 0.81
8 0.75
9 0.72
10 0.65
11 0.64
12 0.62
13 0.56
14 0.51
15 0.5
16 0.53
17 0.5
18 0.49
19 0.44
20 0.42
21 0.39
22 0.36
23 0.33
24 0.26
25 0.24
26 0.23
27 0.2
28 0.14
29 0.15
30 0.14
31 0.14
32 0.13
33 0.11
34 0.09
35 0.08
36 0.08
37 0.06
38 0.07
39 0.07
40 0.07
41 0.1
42 0.11
43 0.15
44 0.2
45 0.26
46 0.28
47 0.32
48 0.38
49 0.38
50 0.38
51 0.35
52 0.32
53 0.33
54 0.28
55 0.28
56 0.25
57 0.25
58 0.27
59 0.27
60 0.28
61 0.27
62 0.34
63 0.41
64 0.42
65 0.49
66 0.47
67 0.51
68 0.52
69 0.49
70 0.43
71 0.35
72 0.31
73 0.21
74 0.22
75 0.18
76 0.16
77 0.17
78 0.18
79 0.19
80 0.2
81 0.24
82 0.25
83 0.29
84 0.32
85 0.39
86 0.48