Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X2G8D0

Protein Details
Accession A0A1X2G8D0   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
17-37SVSPIPERKTWRQRLAFLKDPHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 21, pero 2, E.R. 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR009262  SLC35_F1/F2/F6  
Gene Ontology GO:0016020  C:membrane  
GO:0022857  F:transmembrane transporter activity  
Pfam View protein in Pfam  
PF06027  SLC35F  
Amino Acid Sequences MDQSEKIQVDDLSTQESVSPIPERKTWRQRLAFLKDPAFLKVLFLGQLLSLCITGTNVTTTELANKYNVNAPTMQTFLVYACLAIVYNAYAIYKRGIKGWLLQFWRRGIYYFILGFVDVEGNYFVVKSFQYTSMLSAMLLDCWSTPVCMILSYFFLKVRYRWVQFLGVFIALCGLGMLVASDVITGKNYDAVDPVRGDLFCLLGATFYGISNVGEEFMARKHPLYEVIGMFTFFATFINLVQMMIFERSQFATLVGQPEAVGMIVVYTVCMFVLYSLAPVLFRWGSALLYNLSLLTSDFYGLIFGLGLFGYQVTVMYPFAYVVVILGIAIYYIFPNPTPPMGTFDKDKMEQERRELFGLPTQDEEQPQTVSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.17
3 0.17
4 0.14
5 0.15
6 0.19
7 0.2
8 0.23
9 0.29
10 0.37
11 0.47
12 0.58
13 0.65
14 0.69
15 0.72
16 0.77
17 0.81
18 0.81
19 0.8
20 0.75
21 0.69
22 0.63
23 0.57
24 0.51
25 0.43
26 0.34
27 0.26
28 0.21
29 0.19
30 0.15
31 0.14
32 0.12
33 0.1
34 0.11
35 0.1
36 0.09
37 0.07
38 0.07
39 0.07
40 0.07
41 0.07
42 0.07
43 0.08
44 0.08
45 0.1
46 0.1
47 0.11
48 0.16
49 0.17
50 0.18
51 0.18
52 0.18
53 0.18
54 0.24
55 0.25
56 0.21
57 0.21
58 0.21
59 0.22
60 0.22
61 0.21
62 0.14
63 0.14
64 0.12
65 0.13
66 0.11
67 0.08
68 0.07
69 0.07
70 0.07
71 0.06
72 0.06
73 0.04
74 0.05
75 0.05
76 0.05
77 0.06
78 0.07
79 0.09
80 0.13
81 0.13
82 0.15
83 0.17
84 0.18
85 0.25
86 0.3
87 0.34
88 0.36
89 0.39
90 0.4
91 0.4
92 0.42
93 0.34
94 0.3
95 0.25
96 0.22
97 0.22
98 0.18
99 0.17
100 0.15
101 0.14
102 0.13
103 0.11
104 0.1
105 0.06
106 0.06
107 0.06
108 0.05
109 0.05
110 0.05
111 0.05
112 0.05
113 0.05
114 0.07
115 0.09
116 0.1
117 0.12
118 0.13
119 0.14
120 0.14
121 0.14
122 0.12
123 0.11
124 0.1
125 0.08
126 0.07
127 0.06
128 0.05
129 0.06
130 0.06
131 0.05
132 0.05
133 0.06
134 0.06
135 0.06
136 0.07
137 0.06
138 0.08
139 0.1
140 0.1
141 0.1
142 0.12
143 0.13
144 0.14
145 0.21
146 0.25
147 0.25
148 0.27
149 0.28
150 0.3
151 0.29
152 0.3
153 0.23
154 0.17
155 0.15
156 0.13
157 0.11
158 0.06
159 0.05
160 0.04
161 0.03
162 0.02
163 0.02
164 0.02
165 0.02
166 0.02
167 0.02
168 0.02
169 0.03
170 0.03
171 0.03
172 0.04
173 0.04
174 0.07
175 0.07
176 0.07
177 0.08
178 0.09
179 0.1
180 0.1
181 0.11
182 0.09
183 0.09
184 0.09
185 0.08
186 0.07
187 0.06
188 0.06
189 0.05
190 0.04
191 0.04
192 0.04
193 0.04
194 0.04
195 0.04
196 0.05
197 0.05
198 0.05
199 0.05
200 0.05
201 0.04
202 0.05
203 0.05
204 0.06
205 0.08
206 0.08
207 0.09
208 0.09
209 0.1
210 0.13
211 0.14
212 0.17
213 0.14
214 0.15
215 0.15
216 0.15
217 0.14
218 0.11
219 0.09
220 0.06
221 0.06
222 0.04
223 0.04
224 0.05
225 0.06
226 0.06
227 0.06
228 0.06
229 0.06
230 0.06
231 0.08
232 0.08
233 0.06
234 0.07
235 0.08
236 0.09
237 0.09
238 0.09
239 0.09
240 0.11
241 0.13
242 0.12
243 0.12
244 0.11
245 0.1
246 0.1
247 0.08
248 0.06
249 0.03
250 0.03
251 0.03
252 0.03
253 0.03
254 0.03
255 0.03
256 0.03
257 0.03
258 0.03
259 0.03
260 0.04
261 0.04
262 0.05
263 0.05
264 0.05
265 0.05
266 0.06
267 0.09
268 0.08
269 0.08
270 0.09
271 0.1
272 0.1
273 0.11
274 0.12
275 0.09
276 0.1
277 0.1
278 0.09
279 0.08
280 0.08
281 0.07
282 0.07
283 0.06
284 0.06
285 0.06
286 0.06
287 0.06
288 0.06
289 0.06
290 0.05
291 0.04
292 0.04
293 0.04
294 0.04
295 0.04
296 0.04
297 0.04
298 0.04
299 0.04
300 0.04
301 0.05
302 0.06
303 0.06
304 0.06
305 0.06
306 0.07
307 0.07
308 0.06
309 0.05
310 0.05
311 0.04
312 0.04
313 0.04
314 0.03
315 0.03
316 0.03
317 0.03
318 0.04
319 0.05
320 0.06
321 0.06
322 0.1
323 0.12
324 0.14
325 0.16
326 0.17
327 0.22
328 0.26
329 0.29
330 0.31
331 0.33
332 0.37
333 0.37
334 0.4
335 0.44
336 0.49
337 0.5
338 0.54
339 0.57
340 0.54
341 0.53
342 0.51
343 0.43
344 0.4
345 0.4
346 0.34
347 0.3
348 0.3
349 0.31
350 0.31
351 0.32
352 0.29