Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T4A3T5

Protein Details
Accession A0A2T4A3T5    Localization Confidence Low Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
48-76THFFHNCKKWENKQKEKREKKNPMPVSIYHydrophilic
NLS Segment(s)
PositionSequence
63-66EKRE
Subcellular Location(s) mito 16.5, cyto_mito 11, cyto 4.5, nucl 4
Family & Domain DBs
Amino Acid Sequences MPMISLHFLSPLLDASPVHCPSITTTTLARAGCLQPVRPHSLRANPITHFFHNCKKWENKQKEKREKKNPMPVSIYDVIISFSYHPHFRV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.1
3 0.18
4 0.18
5 0.18
6 0.17
7 0.17
8 0.2
9 0.25
10 0.23
11 0.18
12 0.17
13 0.19
14 0.23
15 0.23
16 0.19
17 0.17
18 0.17
19 0.19
20 0.19
21 0.19
22 0.19
23 0.22
24 0.29
25 0.27
26 0.3
27 0.29
28 0.34
29 0.37
30 0.37
31 0.36
32 0.3
33 0.34
34 0.34
35 0.32
36 0.3
37 0.28
38 0.32
39 0.34
40 0.35
41 0.38
42 0.41
43 0.5
44 0.57
45 0.65
46 0.68
47 0.74
48 0.83
49 0.88
50 0.92
51 0.92
52 0.93
53 0.93
54 0.92
55 0.93
56 0.88
57 0.83
58 0.77
59 0.68
60 0.64
61 0.56
62 0.46
63 0.35
64 0.29
65 0.23
66 0.19
67 0.18
68 0.11
69 0.11
70 0.15