Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2T4AH90

Protein Details
Accession A0A2T4AH90    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
17-42MKGTERERERERRKRWAEQRRGHELRBasic
NLS Segment(s)
PositionSequence
22-35RERERERRKRWAEQ
Subcellular Location(s) nucl 9, mito 6, cyto 5, pero 4, extr 2
Family & Domain DBs
Amino Acid Sequences MGRGRMMMMQWDGAGEMKGTERERERERRKRWAEQRRGHELRDCFDRGNSCHVCTSMSLAFLWTDGQCNAGSKYELQGRSQWRTCIDLFAKTGSWAWAWDRGRDVGMH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.08
3 0.07
4 0.08
5 0.13
6 0.14
7 0.19
8 0.22
9 0.28
10 0.36
11 0.47
12 0.56
13 0.62
14 0.68
15 0.74
16 0.77
17 0.81
18 0.84
19 0.84
20 0.84
21 0.82
22 0.84
23 0.83
24 0.79
25 0.7
26 0.66
27 0.56
28 0.48
29 0.45
30 0.39
31 0.28
32 0.27
33 0.28
34 0.23
35 0.29
36 0.27
37 0.23
38 0.22
39 0.22
40 0.2
41 0.17
42 0.19
43 0.11
44 0.11
45 0.1
46 0.09
47 0.09
48 0.08
49 0.09
50 0.06
51 0.07
52 0.06
53 0.08
54 0.08
55 0.09
56 0.1
57 0.1
58 0.11
59 0.1
60 0.14
61 0.19
62 0.21
63 0.21
64 0.26
65 0.31
66 0.38
67 0.4
68 0.39
69 0.35
70 0.38
71 0.36
72 0.38
73 0.34
74 0.3
75 0.29
76 0.28
77 0.26
78 0.23
79 0.24
80 0.18
81 0.16
82 0.14
83 0.15
84 0.22
85 0.23
86 0.25
87 0.28
88 0.28