Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2T4AAR5

Protein Details
Accession A0A2T4AAR5    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
147-187ITAQGPRRSRQCHPKRNEKRGREKHKGNRKGVKGRRMKTGSBasic
NLS Segment(s)
PositionSequence
154-189RSRQCHPKRNEKRGREKHKGNRKGVKGRRMKTGSGK
Subcellular Location(s) mito_nucl 13, nucl 12.5, mito 12.5
Family & Domain DBs
Amino Acid Sequences MIIIIKICERMRERMKGARVFPIRCQYQGRVYPASVRDDSICHKTRAGHPSSRGRKSNSNNNKKRAAETGQPRSGSQPLTPFIINKESEACRYSNKVFPHTALGKKMRTLADTADHHGSQGLFDSKALPRLVSEDAEQLMRVRLVPITAQGPRRSRQCHPKRNEKRGREKHKGNRKGVKGRRMKTGSGKD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.64
3 0.63
4 0.62
5 0.63
6 0.63
7 0.58
8 0.59
9 0.6
10 0.54
11 0.51
12 0.53
13 0.47
14 0.49
15 0.52
16 0.51
17 0.45
18 0.43
19 0.46
20 0.43
21 0.45
22 0.37
23 0.31
24 0.27
25 0.26
26 0.3
27 0.32
28 0.32
29 0.28
30 0.29
31 0.32
32 0.38
33 0.44
34 0.45
35 0.43
36 0.47
37 0.56
38 0.64
39 0.68
40 0.65
41 0.61
42 0.65
43 0.66
44 0.7
45 0.7
46 0.72
47 0.73
48 0.74
49 0.77
50 0.69
51 0.65
52 0.59
53 0.53
54 0.5
55 0.51
56 0.54
57 0.5
58 0.5
59 0.47
60 0.44
61 0.42
62 0.35
63 0.27
64 0.21
65 0.18
66 0.19
67 0.19
68 0.17
69 0.16
70 0.19
71 0.18
72 0.15
73 0.17
74 0.16
75 0.18
76 0.19
77 0.18
78 0.15
79 0.18
80 0.2
81 0.22
82 0.22
83 0.24
84 0.23
85 0.23
86 0.27
87 0.28
88 0.28
89 0.29
90 0.31
91 0.29
92 0.29
93 0.33
94 0.28
95 0.24
96 0.23
97 0.19
98 0.21
99 0.22
100 0.24
101 0.22
102 0.21
103 0.2
104 0.2
105 0.18
106 0.12
107 0.13
108 0.11
109 0.08
110 0.09
111 0.11
112 0.11
113 0.16
114 0.16
115 0.14
116 0.13
117 0.15
118 0.17
119 0.16
120 0.16
121 0.13
122 0.14
123 0.14
124 0.14
125 0.12
126 0.11
127 0.1
128 0.09
129 0.08
130 0.08
131 0.08
132 0.08
133 0.1
134 0.13
135 0.18
136 0.23
137 0.29
138 0.33
139 0.37
140 0.44
141 0.48
142 0.52
143 0.59
144 0.65
145 0.69
146 0.74
147 0.81
148 0.84
149 0.9
150 0.92
151 0.91
152 0.92
153 0.92
154 0.93
155 0.92
156 0.92
157 0.92
158 0.92
159 0.92
160 0.91
161 0.9
162 0.89
163 0.9
164 0.88
165 0.88
166 0.87
167 0.81
168 0.82
169 0.77
170 0.73