Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T4AVX5

Protein Details
Accession A0A2T4AVX5    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
8-39SILIASYPSHQRRRRKERAKRRYLEEEKKSKTHydrophilic
NLS Segment(s)
PositionSequence
19-31RRRRKERAKRRYL
Subcellular Location(s) mito 16, nucl 6, cyto 2, plas 2
Family & Domain DBs
Amino Acid Sequences MKQSTIPSILIASYPSHQRRRRKERAKRRYLEEEKKSKTMNMISNPQQQSLHLSRMPCKAASLHSNSTSLFSIDMVTLFLGMLLCCFFPS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.28
3 0.37
4 0.44
5 0.54
6 0.64
7 0.73
8 0.81
9 0.84
10 0.88
11 0.9
12 0.93
13 0.94
14 0.9
15 0.87
16 0.87
17 0.86
18 0.85
19 0.83
20 0.81
21 0.74
22 0.71
23 0.64
24 0.54
25 0.47
26 0.42
27 0.39
28 0.33
29 0.35
30 0.36
31 0.43
32 0.43
33 0.41
34 0.35
35 0.29
36 0.31
37 0.28
38 0.27
39 0.21
40 0.21
41 0.24
42 0.28
43 0.3
44 0.23
45 0.22
46 0.2
47 0.22
48 0.26
49 0.28
50 0.28
51 0.28
52 0.3
53 0.29
54 0.3
55 0.26
56 0.21
57 0.15
58 0.11
59 0.1
60 0.09
61 0.09
62 0.07
63 0.06
64 0.06
65 0.06
66 0.06
67 0.05
68 0.05
69 0.05
70 0.06