Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T4A1W3

Protein Details
Accession A0A2T4A1W3    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
84-103GQARNEKRHYDKRHEKVDEKBasic
NLS Segment(s)
Subcellular Location(s) plas 8, extr 6, golg 5, mito 3, E.R. 2, vacu 2, cyto_mito 2
Family & Domain DBs
Amino Acid Sequences MRRLFRLLCFFFFFASIAFLRFSLRILISCIIINWHMTGGNRPAHRRWNVGTFTFTQTHKRSTRVPQSSTRKTAIVNRGKAVLGQARNEKRHYDKRHEKVDEKAFVSPSVSGDEEKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.18
3 0.15
4 0.11
5 0.11
6 0.11
7 0.12
8 0.12
9 0.12
10 0.12
11 0.12
12 0.12
13 0.14
14 0.15
15 0.14
16 0.14
17 0.13
18 0.12
19 0.12
20 0.12
21 0.09
22 0.08
23 0.09
24 0.09
25 0.12
26 0.15
27 0.19
28 0.22
29 0.24
30 0.27
31 0.34
32 0.37
33 0.37
34 0.36
35 0.38
36 0.38
37 0.36
38 0.35
39 0.29
40 0.3
41 0.3
42 0.28
43 0.27
44 0.26
45 0.32
46 0.31
47 0.31
48 0.33
49 0.38
50 0.48
51 0.47
52 0.49
53 0.53
54 0.6
55 0.64
56 0.64
57 0.57
58 0.48
59 0.43
60 0.47
61 0.47
62 0.46
63 0.42
64 0.39
65 0.39
66 0.38
67 0.36
68 0.32
69 0.28
70 0.22
71 0.23
72 0.32
73 0.37
74 0.41
75 0.43
76 0.45
77 0.47
78 0.55
79 0.59
80 0.61
81 0.65
82 0.7
83 0.79
84 0.81
85 0.76
86 0.75
87 0.76
88 0.72
89 0.63
90 0.59
91 0.49
92 0.43
93 0.4
94 0.32
95 0.24
96 0.21
97 0.2