Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T4A5H7

Protein Details
Accession A0A2T4A5H7    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
76-102DKDQRLPPLRKIQQRCKSRRHQSTMELHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13, mito 7, cyto 3, pero 3, cyto_pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR013120  Far_NAD-bd  
Pfam View protein in Pfam  
PF07993  NAD_binding_4  
Amino Acid Sequences MQHTVATDYLGTEILHQLLRCPTIHKVVVLVSADNVRLGLDRVKRRAHLAGWWHPDDEQKVQVWQGNLAAESFGLDKDQRLPPLRKIQQRCKSRRHQSTMELL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.12
3 0.12
4 0.14
5 0.15
6 0.17
7 0.17
8 0.19
9 0.2
10 0.24
11 0.26
12 0.23
13 0.22
14 0.2
15 0.23
16 0.21
17 0.18
18 0.13
19 0.12
20 0.12
21 0.11
22 0.1
23 0.07
24 0.06
25 0.07
26 0.11
27 0.17
28 0.22
29 0.27
30 0.29
31 0.3
32 0.33
33 0.34
34 0.3
35 0.28
36 0.3
37 0.33
38 0.36
39 0.35
40 0.33
41 0.3
42 0.31
43 0.29
44 0.24
45 0.18
46 0.14
47 0.14
48 0.15
49 0.17
50 0.15
51 0.13
52 0.13
53 0.11
54 0.11
55 0.1
56 0.09
57 0.07
58 0.07
59 0.07
60 0.05
61 0.06
62 0.06
63 0.07
64 0.12
65 0.16
66 0.21
67 0.28
68 0.32
69 0.39
70 0.49
71 0.57
72 0.62
73 0.68
74 0.73
75 0.76
76 0.83
77 0.84
78 0.83
79 0.86
80 0.87
81 0.88
82 0.86
83 0.84